Type-1 angiotensin II receptor Recombinant Protein | AGTR1 recombinant protein

Recombinant Human Type-1 angiotensin II receptor

Cat. Num. AAA113907

• Gene Names: AGTR1; AT1; AG2S; AT1B; AT1R; AT1AR; AT1BR; AT2R1; HAT1R; AGTR1B
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Type-1 angiotensin II receptor; N/A; Recombinant Human Type-1 angiotensin II receptor; AT1AR AT1BR Angiotensin II type-1 receptor; AT1; AGTR1 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 297-359aa; partial
• Sequence: LNPLFYGFLGKKFKRYFLQLLKYIPPKAKSHSNLSTKMSTLSYRPSDNVSSSTKKPAPCFEVE

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for AGTR1 recombinant protein

Receptor for angiotensin II. Mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system.

Product Categories/Family for AGTR1 recombinant protein

Cancer

References

Cloning, expression, and characterization of a gene encoding the human angiotensin II type 1A receptor.Mauzy C.A., Hwang O., Egloff A.M., Wu L.H., Chung F.-Z.Biochem. Biophys. Res. Commun. 186:277-284(1992) Molecular cloning and sequencing of the gene encoding human angiotensin II type 1 receptor.Furuta H., Guo D.F., Inagami T.Biochem. Biophys. Res. Commun. 183:8-13(1992) Cloning and characterization of a human angiotensin II type 1 receptor.Bergsma D.J., Ellis C., Kumar C., Nuthalaganti P., Kersten H., Elshourbagy N.A., Griffin E., Stadel J.M., Aiyar N.Biochem. Biophys. Res. Commun. 183:989-995(1992) Molecular cloning, sequence analysis and expression of a cDNA encoding human type-1 angiotensin II receptor.Takayanagi R., Ohnaka K., Sakai Y., Nakao R., Yanase T., Haji M., Inagami T., Furuta H., Gou D.F., Nakamuta M., Nawata H.Biochem. Biophys. Res. Commun. 183:910-916(1992) Genetic analysis of the human type-1 angiotensin II receptor.Curnow K.M., Pascoe L., White P.C.Mol. Endocrinol. 6:1113-1118(1992) Novel subtype of human angiotensin II type 1 receptor cDNA cloning and expression.Konishi H., Kuroda S., Inada Y., Fujisawa Y.Biochem. Biophys. Res. Commun. 199:467-474(1994) Type 1 angiotensin II receptors of adrenal tumors.Nawata H., Takayanagi R., Ohnaka K., Sakai Y., Imasaki K., Yanase T., Ikuyama S., Tanaka S., Ohe K.Steroids 60:28-34(1995) Cloning and sequencing of a human cDNA encoding the angiotensin II receptor type 1.Ostermann E., Castanon M.J. Rapid identification of polymorphisms in genomic DNA a high density SNP map of the type I angiotensin II receptor gene locus on chromosome 3q.Antonellis A., Rogus J.J., Pezzolesi M.G., Makita Y., Nam M., Doria A., Warram J.H., Krolewski A.S.cDNA clones of human proteins involved in signal transduction sequenced by the Guthrie cDNA resource center (www.cdna.org) .Kopatz S.A., Aronstam R.S., Sharma S.V. G-protein-coupled receptor Mas is a physiological antagonist of the angiotensin II type 1 receptor.Kostenis E., Milligan G., Christopoulos A., Sanchez-Ferrer C.F., Heringer-Walther S., Sexton P.M., Gembardt F., Kellett E., Martini L., Vanderheyden P., Schultheiss H.P., Walther T.Circulation 111:1806-1813(2005) A strategy for precise and large scale identification of core fucosylated glycoproteins.Jia W., Lu Z., Fu Y., Wang H.P., Wang L.H., Chi H., Yuan Z.F., Zheng Z.B., Song L.N., Han H.H., Liang Y.M., Wang J.L., Cai Y., Zhang Y.K., Deng Y.L., Ying W.T., He S.M., Qian X.H.Mol. Cell. Proteomics 8:913-923(2009) Mutations in genes in the renin-angiotensin system are associated with autosomal recessive renal tubular dysgenesis.Gribouval O., Gonzales M., Neuhaus T., Aziza J., Bieth E., Laurent N., Bouton J.M., Feuillet F., Makni S., Ben Amar H., Laube G., Delezoide A.-L., Bouvier R., Dijoud F., Ollagnon-Roman E., Roume J., Joubert M., Antignac C., Gubler M.-C.Nat. Genet. 37:964-968(2005)

NCBI and Uniprot Product Information

• NCBI GI #: 4501997
• NCBI GeneID: 185
• NCBI Accession #: NP_000676.1
• NCBI GenBank Nucleotide #: NM_000685.4
• UniProt Accession #: P30556; Q13725; Q8TBK4
• Molecular Weight: 9.2 kDa
• NCBI Official Full Name: type-1 angiotensin II receptor isoform 1
• NCBI Official Synonym Full Names: angiotensin II receptor type 1
• NCBI Official Symbol: AGTR1
• NCBI Official Synonym Symbols: AT1; AG2S; AT1B; AT1R; AT1AR; AT1BR; AT2R1; HAT1R; AGTR1B
• NCBI Protein Information: type-1 angiotensin II receptor
• UniProt Protein Name: Type-1 angiotensin II receptor
• UniProt Gene Name: AGTR1
• UniProt Synonym Gene Names: AGTR1A; AGTR1B; AT2R1; AT2R1B; AT1
• UniProt Entry Name: AGTR1_HUMAN