Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA113907_SDS_PAGE15.jpg SDS-PAGE

Type-1 angiotensin II receptor Recombinant Protein | AGTR1 recombinant protein

Recombinant Human Type-1 angiotensin II receptor

Gene Names
AGTR1; AT1; AG2S; AT1B; AT1R; AT1AR; AT1BR; AT2R1; HAT1R; AGTR1B
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Type-1 angiotensin II receptor; N/A; Recombinant Human Type-1 angiotensin II receptor; AT1AR AT1BR Angiotensin II type-1 receptor; AT1; AGTR1 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
297-359aa; partial
Sequence
LNPLFYGFLGKKFKRYFLQLLKYIPPKAKSHSNLSTKMSTLSYRPSDNVSSSTKKPAPCFEVE
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

product-image-AAA113907_SDS_PAGE15.jpg SDS-PAGE
Related Product Information for AGTR1 recombinant protein
Receptor for angiotensin II. Mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system.
Product Categories/Family for AGTR1 recombinant protein
References
Cloning, expression, and characterization of a gene encoding the human angiotensin II type 1A receptor.Mauzy C.A., Hwang O., Egloff A.M., Wu L.H., Chung F.-Z.Biochem. Biophys. Res. Commun. 186:277-284(1992) Molecular cloning and sequencing of the gene encoding human angiotensin II type 1 receptor.Furuta H., Guo D.F., Inagami T.Biochem. Biophys. Res. Commun. 183:8-13(1992) Cloning and characterization of a human angiotensin II type 1 receptor.Bergsma D.J., Ellis C., Kumar C., Nuthalaganti P., Kersten H., Elshourbagy N.A., Griffin E., Stadel J.M., Aiyar N.Biochem. Biophys. Res. Commun. 183:989-995(1992) Molecular cloning, sequence analysis and expression of a cDNA encoding human type-1 angiotensin II receptor.Takayanagi R., Ohnaka K., Sakai Y., Nakao R., Yanase T., Haji M., Inagami T., Furuta H., Gou D.F., Nakamuta M., Nawata H.Biochem. Biophys. Res. Commun. 183:910-916(1992) Genetic analysis of the human type-1 angiotensin II receptor.Curnow K.M., Pascoe L., White P.C.Mol. Endocrinol. 6:1113-1118(1992) Novel subtype of human angiotensin II type 1 receptor cDNA cloning and expression.Konishi H., Kuroda S., Inada Y., Fujisawa Y.Biochem. Biophys. Res. Commun. 199:467-474(1994) Type 1 angiotensin II receptors of adrenal tumors.Nawata H., Takayanagi R., Ohnaka K., Sakai Y., Imasaki K., Yanase T., Ikuyama S., Tanaka S., Ohe K.Steroids 60:28-34(1995) Cloning and sequencing of a human cDNA encoding the angiotensin II receptor type 1.Ostermann E., Castanon M.J. Rapid identification of polymorphisms in genomic DNA a high density SNP map of the type I angiotensin II receptor gene locus on chromosome 3q.Antonellis A., Rogus J.J., Pezzolesi M.G., Makita Y., Nam M., Doria A., Warram J.H., Krolewski A.S.cDNA clones of human proteins involved in signal transduction sequenced by the Guthrie cDNA resource center (www.cdna.org) .Kopatz S.A., Aronstam R.S., Sharma S.V. G-protein-coupled receptor Mas is a physiological antagonist of the angiotensin II type 1 receptor.Kostenis E., Milligan G., Christopoulos A., Sanchez-Ferrer C.F., Heringer-Walther S., Sexton P.M., Gembardt F., Kellett E., Martini L., Vanderheyden P., Schultheiss H.P., Walther T.Circulation 111:1806-1813(2005) A strategy for precise and large scale identification of core fucosylated glycoproteins.Jia W., Lu Z., Fu Y., Wang H.P., Wang L.H., Chi H., Yuan Z.F., Zheng Z.B., Song L.N., Han H.H., Liang Y.M., Wang J.L., Cai Y., Zhang Y.K., Deng Y.L., Ying W.T., He S.M., Qian X.H.Mol. Cell. Proteomics 8:913-923(2009) Mutations in genes in the renin-angiotensin system are associated with autosomal recessive renal tubular dysgenesis.Gribouval O., Gonzales M., Neuhaus T., Aziza J., Bieth E., Laurent N., Bouton J.M., Feuillet F., Makni S., Ben Amar H., Laube G., Delezoide A.-L., Bouvier R., Dijoud F., Ollagnon-Roman E., Roume J., Joubert M., Antignac C., Gubler M.-C.Nat. Genet. 37:964-968(2005)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
185
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
9.2 kDa
NCBI Official Full Name
type-1 angiotensin II receptor isoform 1
NCBI Official Synonym Full Names
angiotensin II receptor type 1
NCBI Official Symbol
AGTR1
NCBI Official Synonym Symbols
AT1; AG2S; AT1B; AT1R; AT1AR; AT1BR; AT2R1; HAT1R; AGTR1B
NCBI Protein Information
type-1 angiotensin II receptor
UniProt Protein Name
Type-1 angiotensin II receptor
UniProt Gene Name
AGTR1
UniProt Synonym Gene Names
AGTR1A; AGTR1B; AT2R1; AT2R1B; AT1
UniProt Entry Name
AGTR1_HUMAN

Similar Products

Product Notes

The AGTR1 agtr1 (Catalog #AAA113907) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 297-359aa; partial. The amino acid sequence is listed below: LNPLFYGFLG KKFKRYFLQL LKYIPPKAKS HSNLSTKMST LSYRPSDNVS SSTKKPAPCF EVE. It is sometimes possible for the material contained within the vial of "Type-1 angiotensin II receptor, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.