Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA55966_SDS_PAGE15.jpg SDS-PAGE

ALDH1B1 recombinant protein

Recombinant Human ALDH1B1 Protein

Gene Names
ALDH1B1; ALDH5; ALDHX
Applications
SDS-Page, ELISA, Western Blot
Purity
> 90% as determined by SDS-PAGE
Synonyms
ALDH1B1; N/A; Recombinant Human ALDH1B1 Protein; ALDH5; ALDHX; Aldehyde Dehydrogenase X, Mitochondrial; Aldehyde dehydrogenase 5; Aldehyde Dehydrogenase 1 Family, Member B1.; ALDH1B1 recombinant protein
Ordering
Host
E Coli AA 168-517 (P30837).
Purity/Purification
> 90% as determined by SDS-PAGE
Form/Format
The purified protein was resolved in PBS (58 mM Na2HPO4,17 mM NaH2PO4, 68 mM NaCl, pH 7.4). Added with 15 % glycerol. The elution buffer contain 300 mM imidazole
Concentration
0.5 mg/mL (varies by lot)
Sequence
FCFTRHEPVGVCGQIIPWNFPLVMQGWKLAPALATGNTVVMKVAEQTPLSALYLASLIKEAGFPPGVVNIITGYGPTAGAAIAQHMDVDKVAFTGSTEVGHLIQKAAGDSNLKRVTLELGGKSPSIVLADADMEHAVEQCHEALFFNMGQCCCAGSRTFVEESIYNEFLERTVEKAKQRKVGNPFELDTQQGPQVDKEQFERVLGYIQLGQKEGAKLLCGGERFGERGFFIKPTVFGGVQDDMRIAKEEIFGPVQPLFKFKKIEEVVERANNTRYGLAAAVFTRDLDKAMYFTQALQAGTVWVNTYNIVTCHTPFGGFKESGNGRELGEDGLKAYTEVKTVTIKVPQKNS
Sequence Length
517
Applicable Applications for ALDH1B1 recombinant protein
SDS-PAGE, ELISA, WB (Western Blot)
Source
Human
Protein Residue
N-terminal 6*His-tagged.
Usage
ALDH1B1 Protein - Centrifuge the standard vial at 6000-10000rpm for 30s.
Preparation and Storage
Store it under sterile conditions at -20°C upon receiving. Recommend to aliquot the protein into smaller quantities for optimal storage.
**Avoid repeated freeze-thaw cycles.**
Stability :The recombinant protein is stable for up to 6-12 months from date of receipt at -80°C.

SDS-PAGE

product-image-AAA55966_SDS_PAGE15.jpg SDS-PAGE
Related Product Information for ALDH1B1 recombinant protein
Background: ALDH1B1 belongs to the aldehyde dehydrogenases family of proteins. Aldehyde dehydrogenase is the second enzyme of the major oxidative pathway of alcohol metabolism. This gene does not contain introns in the coding sequence. The variation of this locus may affect the development of alcohol-related problems. Hsu et al. (1989) cloned a novel ALDH gene, ALDH5, from a cosmid human DNA library. Although it contains no introns, Northern blot hybridization of human liver RNA revealed a unique mRNA component that hybridized with this gene probe but with neither the ALDH1 probe or the ALDH2 probe. ALDH5 encodes a deduced 517-amino acid protein that shares 70.6% and 62.8% sequence identity with the ALDH2 and ALDH1 proteins, respectively.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
219
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Predicted MW: 42 kDa
Observed MW: 42 kDa
NCBI Official Full Name
aldehyde dehydrogenase X, mitochondrial
NCBI Official Synonym Full Names
aldehyde dehydrogenase 1 family member B1
NCBI Official Symbol
ALDH1B1
NCBI Official Synonym Symbols
ALDH5; ALDHX
NCBI Protein Information
aldehyde dehydrogenase X, mitochondrial
UniProt Protein Name
Aldehyde dehydrogenase X, mitochondrial
UniProt Gene Name
ALDH1B1
UniProt Synonym Gene Names
ALDH5; ALDHX
UniProt Entry Name
AL1B1_HUMAN

Similar Products

Product Notes

The ALDH1B1 aldh1b1 (Catalog #AAA55966) is a Recombinant Protein produced from E Coli AA 168-517 (P30837). and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's ALDH1B1 can be used in a range of immunoassay formats including, but not limited to, SDS-PAGE, ELISA, WB (Western Blot). Researchers should empirically determine the suitability of the ALDH1B1 aldh1b1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: FCFTRHEPVG VCGQIIPWNF PLVMQGWKLA PALATGNTVV MKVAEQTPLS ALYLASLIKE AGFPPGVVNI ITGYGPTAGA AIAQHMDVDK VAFTGSTEVG HLIQKAAGDS NLKRVTLELG GKSPSIVLAD ADMEHAVEQC HEALFFNMGQ CCCAGSRTFV EESIYNEFLE RTVEKAKQRK VGNPFELDTQ QGPQVDKEQF ERVLGYIQLG QKEGAKLLCG GERFGERGFF IKPTVFGGVQ DDMRIAKEEI FGPVQPLFKF KKIEEVVERA NNTRYGLAAA VFTRDLDKAM YFTQALQAGT VWVNTYNIVT CHTPFGGFKE SGNGRELGED GLKAYTEVKT VTIKVPQKNS. It is sometimes possible for the material contained within the vial of "ALDH1B1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.