Arachidonate 5-lipoxygenase-activating protein (ALOX5AP) Recombinant Protein | ALOX5AP recombinant protein
Recombinant Human Arachidonate 5-lipoxygenase-activating protein (ALOX5AP)
Gene Names
ALOX5AP; FLAP
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Arachidonate 5-lipoxygenase-activating protein (ALOX5AP); N/A; Recombinant Human Arachidonate 5-lipoxygenase-activating protein (ALOX5AP); ALOX5AP recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-161aa; Full Length
Sequence
MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP
Sequence Length
161
Species
Human
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for ALOX5AP recombinant protein
Required for leukotriene biosynthesis by ALOX5 (5-lipoxygenase). Anchors ALOX5 to the membrane. Binds arachidonic acid, and could play an essential role in the transfer of arachidonic acid to ALOX5. Binds to MK-886, a compound that blocks the biosynthesis of leukotrienes.
Product Categories/Family for ALOX5AP recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
34.2 kDa
NCBI Official Full Name
arachidonate 5-lipoxygenase-activating protein isoform 2
NCBI Official Synonym Full Names
arachidonate 5-lipoxygenase activating protein
NCBI Official Symbol
ALOX5AP
NCBI Official Synonym Symbols
FLAP
NCBI Protein Information
arachidonate 5-lipoxygenase-activating protein
UniProt Protein Name
Arachidonate 5-lipoxygenase-activating protein
UniProt Gene Name
ALOX5AP
UniProt Synonym Gene Names
FLAP
UniProt Entry Name
AL5AP_HUMAN
Similar Products
Product Notes
The ALOX5AP alox5ap (Catalog #AAA230600) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-161aa; Full Length. The amino acid sequence is listed below: MDQETVGNVV LLAIVTLISV VQNGFFAHKV EHESRTQNGR SFQRTGTLAF ERVYTANQNC VDAYPTFLAV LWSAGLLCSQ VPAAFAGLMY LFVRQKYFVG YLGERTQSTP GYIFGKRIIL FLFLMSVAGI FNYYLIFFFG SDFENYIKTI STTISPLLLI P. It is sometimes possible for the material contained within the vial of "Arachidonate 5-lipoxygenase-activating protein (ALOX5AP), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.