Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us

Intestinal-type alkaline phosphatase 1 (Alpi) Recombinant Protein | Alpi recombinant protein

Recombinant Rat Intestinal-type alkaline phosphatase 1 (Alpi)

Gene Names
Alpi; Alp1; S51097
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Intestinal-type alkaline phosphatase 1 (Alpi); N/A; Recombinant Rat Intestinal-type alkaline phosphatase 1 (Alpi); Alpi recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
21-511aa; Full Length of Mature Protein
Sequence
VIPVEEENPVFWNQKAKEALDVAKKLQPIQTSAKNLILFLGDGMGVPTVTATRILKGQLGGHLGPETPLAMDHFPFTALSKTYNVDRQVPDSAGTATAYLCGVKANYKTIGVSAAARFNQCNSTFGNEVFSVMHRAKKAGKSVGVVTTTRVQHASPAGTYAHTVNRDWYSDADMPSSALQEGCKDIATQLISNMDIDVILGGGRKFMFPKGTPDPEYPGDSDQSGVRLDSRNLVEEWLAKYQGTRYVWNREQLMQASQDPAVTRLMGLFEPTEMKYDVNRNASADPSLAEMTEVAVRLLSRNPQGFYLFVEGGRIDQGHHAGTAYLALTEAVMFDSAIEKASQLTNEKDTLTLITADHSHVFAFGGYTLRGTSIFGLAPLNAQDGKSYTSILYGNGPGYVLNSGNRPNVTDAESGDVNYKQQAAVPLSSETHGGEDVAIFARGPQAHLVHGVQEQNYIAHVMAFAGCLEPYTDCGLAPPADENRPTTPVQN
Species
Rat
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Alpi recombinant protein
There are at least four distinct but related alkaline phosphatases: intestinal, placental, placental-like, and liver
bone
kidney (tissue non-specific). The intestinal alkaline phosphatase gene encodes a digestive brush-border enzyme. This enzyme is upregulated during small intestinal epithelial cell differentiation.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
58,402 Da
NCBI Official Full Name
Intestinal-type alkaline phosphatase 1
NCBI Official Synonym Full Names
alkaline phosphatase, intestinal
NCBI Official Symbol
Alpi
NCBI Official Synonym Symbols
Alp1; S51097
NCBI Protein Information
intestinal-type alkaline phosphatase 1
UniProt Protein Name
Intestinal-type alkaline phosphatase 1
UniProt Gene Name
Alpi
UniProt Synonym Gene Names
IAP-1; Intestinal alkaline phosphatase 1; IAP-I

Similar Products

Product Notes

The Alpi alpi (Catalog #AAA114032) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 21-511aa; Full Length of Mature Protein. The amino acid sequence is listed below: VIPVEEENPV FWNQKAKEAL DVAKKLQPIQ TSAKNLILFL GDGMGVPTVT ATRILKGQLG GHLGPETPLA MDHFPFTALS KTYNVDRQVP DSAGTATAYL CGVKANYKTI GVSAAARFNQ CNSTFGNEVF SVMHRAKKAG KSVGVVTTTR VQHASPAGTY AHTVNRDWYS DADMPSSALQ EGCKDIATQL ISNMDIDVIL GGGRKFMFPK GTPDPEYPGD SDQSGVRLDS RNLVEEWLAK YQGTRYVWNR EQLMQASQDP AVTRLMGLFE PTEMKYDVNR NASADPSLAE MTEVAVRLLS RNPQGFYLFV EGGRIDQGHH AGTAYLALTE AVMFDSAIEK ASQLTNEKDT LTLITADHSH VFAFGGYTLR GTSIFGLAPL NAQDGKSYTS ILYGNGPGYV LNSGNRPNVT DAESGDVNYK QQAAVPLSSE THGGEDVAIF ARGPQAHLVH GVQEQNYIAH VMAFAGCLEP YTDCGLAPPA DENRPTTPVQ N. It is sometimes possible for the material contained within the vial of "Intestinal-type alkaline phosphatase 1 (Alpi), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.