SDS-PAGE
Alkaline phosphatase, placental type (ALPP) Recombinant Protein | ALPP recombinant protein
Recombinant Human Alkaline phosphatase, placental type (ALPP) , partial
Gene Names
ALPP; ALP; PALP; PLAP; PLAP-1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Alkaline phosphatase, placental type (ALPP); N/A; Recombinant Human Alkaline phosphatase, placental type (ALPP) , partial; ALPP recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
117-447aa; Partial
Sequence
TATAYLCGVKGNFQTIGLSAAARFNQCNTTRGNEVISVMNRAKKAGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDADVPASARQEGCQDIATQLISNMDIDVILGGGRKYMFRMGTPDPEYPDDYSQGGTRLDGKNLVQEWLAKRQGARYVWNRTELMQASLDPSVTHLMGLFEPGDMKYEIHRDSTLDPSLMEMTEAALRLLSRNPRGFFLFVEGGRIDHGHHESRAYRALTETIMFDDAIERAGQLTSEEDTLSLVTADHSHVFSFGGYPLRGSSIFGLAPGKARDRKAYTVLLYGNGPGYVLKDGARPDVTESESGSPEYRQQSAV
Sequence Length
535
Species
Homo sapiens (Human)
Production Note
Special Offer: The Baculovirus, E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. Baculovirus, E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The Baculovirus, E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select Baculovirus, E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our or email to for more details.
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
SDS-PAGE
SDS-PAGE
Related Product Information for ALPP recombinant protein
In most mammals there are four different isozymes: placental, placental-like, intestinal and tissue non-specific (liver
bone
kidney).
bone
kidney).
Product Categories/Family for ALPP recombinant protein
References
"Nucleotide sequence of the human placental alkaline phosphatase gene. Evolution of the 5' flanking region by deletion substitution." Knoll B.J., Rothblum K.N., Longley M.A. J. Biol. Chem. 263:12020-12027(1988)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
38.9 kDa
NCBI Official Full Name
alkaline phosphatase, placental type preproprotein
NCBI Official Synonym Full Names
alkaline phosphatase, placental
NCBI Official Symbol
ALPP
NCBI Official Synonym Symbols
ALP; PALP; PLAP; PLAP-1
NCBI Protein Information
alkaline phosphatase, placental type
UniProt Protein Name
Alkaline phosphatase, placental type
UniProt Gene Name
ALPP
UniProt Synonym Gene Names
PLAP; PLAP-1
Similar Products
Product Notes
The ALPP alpp (Catalog #AAA113441) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 117-447aa; Partial. The amino acid sequence is listed below: TATAYLCGVK GNFQTIGLSA AARFNQCNTT RGNEVISVMN RAKKAGKSVG VVTTTRVQHA SPAGTYAHTV NRNWYSDADV PASARQEGCQ DIATQLISNM DIDVILGGGR KYMFRMGTPD PEYPDDYSQG GTRLDGKNLV QEWLAKRQGA RYVWNRTELM QASLDPSVTH LMGLFEPGDM KYEIHRDSTL DPSLMEMTEA ALRLLSRNPR GFFLFVEGGR IDHGHHESRA YRALTETIMF DDAIERAGQL TSEEDTLSLV TADHSHVFSF GGYPLRGSSI FGLAPGKARD RKAYTVLLYG NGPGYVLKDG ARPDVTESES GSPEYRQQSA V. It is sometimes possible for the material contained within the vial of "Alkaline phosphatase, placental type (ALPP), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.