Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA113315_AD15.jpg Application Data

Pancreatic alpha-amylase (AMY2A) Recombinant Protein | AMY2A recombinant protein

Recombinant Human Pancreatic alpha-amylase (AMY2A)

Average rating 0.0
No ratings yet
Gene Names
AMY2A; PA; AMY2; AMY2B
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Pancreatic alpha-amylase (AMY2A); N/A; Recombinant Human Pancreatic alpha-amylase (AMY2A); Pancreatic alpha-amylase; PA; EC=3.2.1.1; 1,4-alpha-D-glucan glucanohydrolase; AMY2A recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
16-511aa; Full Length of Mature Protein
Sequence
QYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Application Data

product-image-AAA113315_AD15.jpg Application Data

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
279
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30,302 Da
NCBI Official Full Name
pancreatic alpha-amylase
NCBI Official Synonym Full Names
amylase, alpha 2A (pancreatic)
NCBI Official Symbol
AMY2A
NCBI Official Synonym Symbols
PA; AMY2; AMY2B
NCBI Protein Information
pancreatic alpha-amylase; glycogenase; found in the pancreas; pancreatic amylase 2A; pancreatic amylase alpha 2A; amylase, pancreatic, alpha-2A; 1,4-alpha-D-glucan glucanohydrolase
UniProt Protein Name
Pancreatic alpha-amylase
UniProt Gene Name
AMY2A
UniProt Synonym Gene Names
PA
UniProt Entry Name
AMYP_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The AMY2A amy2a (Catalog #AAA113315) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 16-511aa; Full Length of Mature Protein. The amino acid sequence is listed below: QYSPNTQQGR TSIVHLFEWR WVDIALECER YLAPKGFGGV QVSPPNENVA IYNPFRPWWE RYQPVSYKLC TRSGNEDEFR NMVTRCNNVG VRIYVDAVIN HMCGNAVSAG TSSTCGSYFN PGSRDFPAVP YSGWDFNDGK CKTGSGDIEN YNDATQVRDC RLTGLLDLAL EKDYVRSKIA EYMNHLIDIG VAGFRLDASK HMWPGDIKAI LDKLHNLNSN WFPAGSKPFI YQEVIDLGGE PIKSSDYFGN GRVTEFKYGA KLGTVIRKWN GEKMSYLKNW GEGWGFVPSD RALVFVDNHD NQRGHGAGGA SILTFWDARL YKMAVGFMLA HPYGFTRVMS SYRWPRQFQN GNDVNDWVGP PNNNGVIKEV TINPDTTCGN DWVCEHRWRQ IRNMVIFRNV VDGQPFTNWY DNGSNQVAFG RGNRGFIVFN NDDWSFSLTL QTGLPAGTYC DVISGDKING NCTGIKIYVS DDGKAHFSIS NSAEDPFIAI HAESKL. It is sometimes possible for the material contained within the vial of "Pancreatic alpha-amylase (AMY2A), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.