Angiopoietin 2 Recombinant Protein | ANG2 recombinant protein
Recombinant Human Angiopoietin 2 (ANG2)
Gene Names
ANGPT2; ANG2; AGPT2
Applications
ELISA, Western Blot
Purity
> 90 % as determined by SDS-PAGE.
Synonyms
Angiopoietin 2; N/A; Recombinant Human Angiopoietin 2 (ANG2); ANG-2; AGPT2; ANGPT2.; ANG2 recombinant protein
Host
E.coli 19-485AA (O15123).
Purity/Purification
> 90 % as determined by SDS-PAGE.
Form/Format
10 mM Tris-HCl, 1 mM EDTA, pH 8.0, with 20% glycerol.
Concentration
0.16 mg/mL (varies by lot)
Sequence
YNNFRKSMDSIGKKQYQVQHGSCSYTFLLPEMDNCRSSSSPYVSNAVQRDAPLEYDDSVQRLQVLENIMENNTQWLMKLENYIQDNMKKEMVEIQQNAVQNQTAVMIEIGTNLLNQTAEQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSEINKLQDKNSFLEKKVLAMEDKHIIQLQSIKEEKDQLQVLVSKQNSIIEELEKKIVTATVNNSVLQKQQHDLMETVNNLLTMMSTSNSAKDPTVAKEEQISFRDCAEVFKSGHTTNGIYTLTFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDGDNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLK
Sequence Length
495
Applicable Applications for ANG2 recombinant protein
ELISA, WB (Western Blot)
Source
Human
Endotoxin
< 1.0 EU per ug of the protein as determined by the LAL method
Protein residues
With N-terminal 6xHis-tagged.
Usage
ANG2 Protein - Centrifuge the standard vial at 6000-10000rpm for 30s.
Preparation and Storage
Storage:
Store it under sterile conditions at -20°C to -80°C upon receiving. Recommend to aliquot the protein into smaller quantities for optimal storage.
**Avoid repeated freeze-thaw cycles.**
Stability:
The recombinant protein is stable for up to 12 months from date of receipt at -80°C.
Store it under sterile conditions at -20°C to -80°C upon receiving. Recommend to aliquot the protein into smaller quantities for optimal storage.
**Avoid repeated freeze-thaw cycles.**
Stability:
The recombinant protein is stable for up to 12 months from date of receipt at -80°C.
Related Product Information for ANG2 recombinant protein
Angiopoietin-2 (Ang-2) is a secreted glycoprotein that plays a complex role in vascular development. Ang-2 contains an N-terminal coiled-coildomain, 58-254 amino acids (aa) and a C-terminal fibrinogen-like domain, 281-467 aa, that is also found in other proteins including fibrinogen, tenascin, and ficolin. Located at the N-terminus are stretches of hydrophobic residues typical of secretory signal sequences. While Ang-2 is widely expressed in the mouse embryo, it is restricted postnatally to pro-angiogenic regions including the placenta, ovaries, and uterus. Ang-2 has been implicated in cancer development due to its role in angiogenesis. Ang-2-mediated destabilization of mature vessel structures accompanied by the presence of VEGF, may contribute to the angiogenesis associated with tumor tissues.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
Predicted MW: 57.7 kDa
Observed MW: 57 kDa
Observed MW: 57 kDa
NCBI Official Full Name
Angiopoietin 2
NCBI Official Synonym Full Names
angiopoietin 2
NCBI Official Symbol
ANGPT2
NCBI Official Synonym Symbols
ANG2; AGPT2
NCBI Protein Information
angiopoietin-2; ANG-2; Tie2-ligand; angiopoietin-2B; angiopoietin-2a
UniProt Protein Name
Angiopoietin-2
UniProt Gene Name
ANGPT2
UniProt Synonym Gene Names
ANG-2
UniProt Entry Name
ANGP2_HUMAN
Similar Products
Product Notes
The ANG2 angpt2 (Catalog #AAA55770) is a Recombinant Protein produced from E.coli 19-485AA (O15123). and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Angiopoietin 2 can be used in a range of immunoassay formats including, but not limited to, ELISA, WB (Western Blot). Researchers should empirically determine the suitability of the ANG2 angpt2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: YNNFRKSMDS IGKKQYQVQH GSCSYTFLLP EMDNCRSSSS PYVSNAVQRD APLEYDDSVQ RLQVLENIME NNTQWLMKLE NYIQDNMKKE MVEIQQNAVQ NQTAVMIEIG TNLLNQTAEQ TRKLTDVEAQ VLNQTTRLEL QLLEHSLSTN KLEKQILDQT SEINKLQDKN SFLEKKVLAM EDKHIIQLQS IKEEKDQLQV LVSKQNSIIE ELEKKIVTAT VNNSVLQKQQ HDLMETVNNL LTMMSTSNSA KDPTVAKEEQ ISFRDCAEVF KSGHTTNGIY TLTFPNSTEE IKAYCDMEAG GGGWTIIQRR EDGSVDFQRT WKEYKVGFGN PSGEYWLGNE FVSQLTNQQR YVLKIHLKDW EGNEAYSLYE HFYLSSEELN YRIHLKGLTG TAGKISSISQ PGNDFSTKDG DNDKCICKCS QMLTGGWWFD ACGPSNLNGM YYPQRQNTNK FNGIKWYYWK GSGYSLK. It is sometimes possible for the material contained within the vial of "Angiopoietin 2, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.