AP-2 complex subunit sigma (AP2S1) Recombinant Protein | AP2S1 recombinant protein
Recombinant Human AP-2 complex subunit sigma (AP2S1)
Gene Names
AP2S1; AP17; FBH3; HHC3; FBHOk; CLAPS2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
AP-2 complex subunit sigma (AP2S1); N/A; Recombinant Human AP-2 complex subunit sigma (AP2S1); AP2S1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-142aa; Full Length
Sequence
MIRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKHTNFVEFRNFKIIYRRYAGLYFCICVDVNDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFLAGEIRETSQTKVLKQLLMLQSLE
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for AP2S1 recombinant protein
One of two major clathrin-associated adaptor complexes, AP-2, is a heterotetramer which is associated with the plasma membrane. This complex is composed of two large chains, a medium chain, and a small chain. This gene encodes the small chain of this complex. Alternative splicing has been observed in this gene and results in two known transcripts.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
12,417 Da
NCBI Official Full Name
AP-2 complex subunit sigma isoform 3
NCBI Official Synonym Full Names
adaptor related protein complex 2 sigma 1 subunit
NCBI Official Symbol
AP2S1
NCBI Official Synonym Symbols
AP17; FBH3; HHC3; FBHOk; CLAPS2
NCBI Protein Information
AP-2 complex subunit sigma
UniProt Protein Name
AP-2 complex subunit sigma
UniProt Gene Name
AP2S1
UniProt Synonym Gene Names
AP17; CLAPS2
Similar Products
Product Notes
The AP2S1 ap2s1 (Catalog #AAA113468) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-142aa; Full Length. The amino acid sequence is listed below: MIRFILIQNR AGKTRLAKWY MQFDDDEKQK LIEEVHAVVT VRDAKHTNFV EFRNFKIIYR RYAGLYFCIC VDVNDNNLAY LEAIHNFVEV LNEYFHNVCE LDLVFNFYKV YTVVDEMFLA GEIRETSQTK VLKQLLMLQS LE. It is sometimes possible for the material contained within the vial of "AP-2 complex subunit sigma (AP2S1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.