Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA55950_SDS_PAGE15.jpg SDS-PAGE

apolipoprotein B48 (APOB) Recombinant Protein | APOB recombinant protein

Recombinant Human apolipoprotein B48 (APOB) Protein

Average rating 0.0
No ratings yet
Gene Names
APOBR; APOB48R; APOB100R
Purity
> 90% as determined by SDS-PAGE
Synonyms
apolipoprotein B48 (APOB); N/A; Recombinant Human apolipoprotein B48 (APOB) Protein; Apo-B; FLDB; Apo B-100; Apo B-48.; APOB recombinant protein
Ordering
Host
E. coli AA 28-127 (P04114).
Purity/Purification
> 90% as determined by SDS-PAGE
Form/Format
10 mM Tris-HCl, 1 mM EDTA, pH 8.0, 50% glycerol.
Concentration
0.75 mg/mL (varies by lot)
Sequence
EEEMLENVSLVCPKDATRFKHLRKYTYNYEAESSSGVPGTADSRSATRINCKVELEVPQLCSFILKTSQCTLKEVYGFNPEGKALLKKTKNSEEFAAAMS
Species
Human
Source
Human
Protein Residues
with N-terminal 10×His-tagged.
Endotoxin Level
Please contact us for more information.
Usage
APOB Protein - Centrifuge the standard vial at 6000-10000rpm for 30s.
Preparation and Storage
Store it under sterile conditions at -20°C upon receiving. Recommend to aliquot the protein into smaller quantities for optimal storage. The recombinant protein is stable for up to 6-12 months from date of receipt at -20°C to -80°C. **Avoid repeated freeze-thaw cycles.**

SDS-PAGE

product-image-AAA55950_SDS_PAGE15.jpg SDS-PAGE
Related Product Information for APOB recombinant protein
Apolipoprotein B (APOB) is the primary apolipoprotein of low-density lipoproteins (LDL or "bad cholesterol"), which is responsible for carrying cholesterol to tissues. While it is unclear exactly what functional role APOB plays in LDL, it is the primary apolipoprotein component and is absolutely required for its formation. What is clear is that the APOB on the LDL particle acts as a ligand for LDL receptors in various cells throughout the body. Through a mechanism that is not fully understood, high levels of APOB can lead to plaques that cause vascular disease (atherosclerosis), leading to heart disease. There is considerable evidence that levels of APOB are a better indicator of heart disease risk than total cholesterol or LDL.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Predicted MW: 14.7 kDa
Observed MW: 17 kDa
(The reducing (R) protein migrates as xx kDa in SDS-PAGE may be due to relative charge.)
NCBI Official Full Name
apolipoprotein B receptor
NCBI Official Synonym Full Names
apolipoprotein B receptor
NCBI Official Symbol
APOBR
NCBI Official Synonym Symbols
APOB48R; APOB100R
NCBI Protein Information
apolipoprotein B receptor
UniProt Protein Name
Apolipoprotein B receptor
UniProt Gene Name
APOBR
UniProt Synonym Gene Names
APOB48R; Apolipoprotein B48 receptor; apoB-48R
UniProt Entry Name
APOBR_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The APOB apobr (Catalog #AAA55950) is a Recombinant Protein produced from E. coli AA 28-127 (P04114). and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: EEEMLENVSL VCPKDATRFK HLRKYTYNYE AESSSGVPGT ADSRSATRIN CKVELEVPQL CSFILKTSQC TLKEVYGFNP EGKALLKKTK NSEEFAAAMS. It is sometimes possible for the material contained within the vial of "apolipoprotein B48 (APOB), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.