Apolipoprotein C-III Recombinant Protein | APOC3 recombinant protein

Recombinant Human Apolipoprotein C-III

Cat. Num. AAA114123

• Gene Names: APOC3; HALP2; APOCIII
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Apolipoprotein C-III; N/A; Recombinant Human Apolipoprotein C-III; Apolipoprotein C3; APOC3 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 21-99aa; Full Length of Mature Protein
• Sequence: SEAEDASLLSFMQGYMKHATKTAKDALSSVQESQVAQQARGWVTDGFSSLKDYWSTVKDKFSEFWDLDPEVRPTSAVAA

• Production Note: Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our or email to for more details.
• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for APOC3 recombinant protein

Component of triglyceride-rich very low density lipoproteins (VLDL) and high density lipoproteins (HDL) in plasma. Plays a multifaceted role in triglyceride homeostasis. Intracellularly, promotes hepatic very low density lipoprotein 1 (VLDL1) assembly and secretion; extracellularly, attenuates hydrolysis and clearance of triglyceride-rich lipoproteins (TRLs). Impairs the lipolysis of TRLs by inhibiting lipoprotein lipase and the hepatic uptake of TRLs by remnant receptors.

Product Categories/Family for APOC3 recombinant protein

Metabolism

References

Isolation and sequence analysis of the human apolipoprotein CIII gene and the intergenic region between the apo AI and apo CIII genes.Protter A.A., Levy-Wilson B., Miller J., Bencen G., White T., Seilhamer J.J.DNA 3:449-456(1984) Isolation and DNA sequence of full-length cDNA for human preapolipoprotein CIII.Levy-Wilson B., Appleby V., Protter A.A., Auperin D., Seilhamer J.J.DNA 3:359-364(1984) Isolation and characterization of cDNA clones corresponding to two different human apoC-III alleles.Karathanasis S.K., Zannis V.I., Breslow J.L.J. Lipid Res. 26:451-456(1985) Human apolipoproteins AI, AII, CII and CIII. cDNA sequences and mRNA abundance.Sharpe C.R., Sidoli A., Shelley C.S., Lucero M.A., Shoulders C.C., Baralle F.E.Nucleic Acids Res. 12:3917-3932(1984) The effects of scale variation in the APOA1/C3/A4/A5 gene cluster.Fullerton S.M., Buchanan A.V., Sonpar V.A., Taylor S.L., Smith J.D., Carlson C.S., Salomaa V., Stengaard J.H., Boerwinkle E., Clark A.G., Nickerson D.A., Weiss K.M.Hum. Genet. 115:36-56(2004) Amino acid sequence of human plasma apolipoprotein C-III from normolipidemic subjects.Hospattankar A.V., Brewer H.B. Jr., Ronan R., Fairwell T.FEBS Lett. 197:67-73(1986) The complete amino acid sequence of alanine apolipoprotein (apoC-3) , and apolipoprotein from human plasma very low density lipoproteins.Brewer H.B. Jr., Shulman R., Herbert P., Ronan R., Wehrly K.J. Biol. Chem. 249:4975-4984(1974) An ABC of apolipoprotein C-III a clinically useful new cardiovascular risk factor?Chan D.C., Chen M.M., Ooi E.M., Watts G.F.Int. J. Clin. Pract. 62:799-809(2008) Enrichment of glycopeptides for glycan structure and attachment site identification.Nilsson J., Rueetschi U., Halim A., Hesse C., Carlsohn E., Brinkmalm G., Larson G.Nat. Methods 6:809-811(2009) Initial characterization of the human central proteome.Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17(2011) Apolipoprotein C-III and hepatic triglyceride-rich lipoprotein production.Yao Z., Wang Y.Curr. Opin. Lipidol. 23:206-212(2012) Identification of new apolipoprotein-CIII glycoforms with ultrahigh resolution MALDI-FTICR mass spectrometry of human sera.Nicolardi S., van der Burgt Y.E., Dragan I., Hensbergen P.J., Deelder A.M.J. Proteome Res. 12:2260-2268(2013) An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.J. Proteomics 96:253-262(2014) Molecular cloning of a human apoC-III variant Thr 74-->Ala 74 mutation prevents O-glycosylation.Maeda H., Hashimoto R.K., Oguro T., Hiraga S., Uzawa H.J. Lipid Res. 28:1405-1409(1987) Apolipoprotein C-III(Lys-58-->Glu) . Identification of an apolipoprotein C-III variant in a family with hyperalphalipoproteinemia.von Eckardstein A., Holz H., Sandkamp M., Weng W., Funke H., Assmann G.J. Clin. Invest. 87:1724-1731(1991)

NCBI and Uniprot Product Information

• NCBI GI #: 4557323
• NCBI GeneID: 345
• NCBI Accession #: NP_000031.1
• NCBI GenBank Nucleotide #: NM_000040.1
• UniProt Accession #: P02656; Q08E83; Q6Q786
• Molecular Weight: 24.8 kDa
• NCBI Official Full Name: apolipoprotein C-III
• NCBI Official Synonym Full Names: apolipoprotein C-III
• NCBI Official Symbol: APOC3
• NCBI Official Synonym Symbols: HALP2; APOCIII
• NCBI Protein Information: apolipoprotein C-III
• UniProt Protein Name: Apolipoprotein C-III
• UniProt Gene Name: APOC3
• UniProt Synonym Gene Names: Apo-CIII; ApoC-III
• UniProt Entry Name: APOC3_HUMAN