Apolipoprotein C-III Recombinant Protein | APOC3 recombinant protein
Recombinant Human Apolipoprotein C-III
Gene Names
APOC3; HALP2; APOCIII
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Apolipoprotein C-III; N/A; Recombinant Human Apolipoprotein C-III; Apolipoprotein C3; APOC3 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
21-99aa; Full Length of Mature Protein
Sequence
SEAEDASLLSFMQGYMKHATKTAKDALSSVQESQVAQQARGWVTDGFSSLKDYWSTVKDKFSEFWDLDPEVRPTSAVAA
Production Note
Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our or email to for more details.
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Related Product Information for APOC3 recombinant protein
Component of triglyceride-rich very low density lipoproteins (VLDL) and high density lipoproteins (HDL) in plasma. Plays a multifaceted role in triglyceride homeostasis. Intracellularly, promotes hepatic very low density lipoprotein 1 (VLDL1) assembly and secretion; extracellularly, attenuates hydrolysis and clearance of triglyceride-rich lipoproteins (TRLs). Impairs the lipolysis of TRLs by inhibiting lipoprotein lipase and the hepatic uptake of TRLs by remnant receptors.
Product Categories/Family for APOC3 recombinant protein
References
Isolation and sequence analysis of the human apolipoprotein CIII gene and the intergenic region between the apo AI and apo CIII genes.Protter A.A., Levy-Wilson B., Miller J., Bencen G., White T., Seilhamer J.J.DNA 3:449-456(1984) Isolation and DNA sequence of full-length cDNA for human preapolipoprotein CIII.Levy-Wilson B., Appleby V., Protter A.A., Auperin D., Seilhamer J.J.DNA 3:359-364(1984) Isolation and characterization of cDNA clones corresponding to two different human apoC-III alleles.Karathanasis S.K., Zannis V.I., Breslow J.L.J. Lipid Res. 26:451-456(1985) Human apolipoproteins AI, AII, CII and CIII. cDNA sequences and mRNA abundance.Sharpe C.R., Sidoli A., Shelley C.S., Lucero M.A., Shoulders C.C., Baralle F.E.Nucleic Acids Res. 12:3917-3932(1984) The effects of scale variation in the APOA1/C3/A4/A5 gene cluster.Fullerton S.M., Buchanan A.V., Sonpar V.A., Taylor S.L., Smith J.D., Carlson C.S., Salomaa V., Stengaard J.H., Boerwinkle E., Clark A.G., Nickerson D.A., Weiss K.M.Hum. Genet. 115:36-56(2004) Amino acid sequence of human plasma apolipoprotein C-III from normolipidemic subjects.Hospattankar A.V., Brewer H.B. Jr., Ronan R., Fairwell T.FEBS Lett. 197:67-73(1986) The complete amino acid sequence of alanine apolipoprotein (apoC-3) , and apolipoprotein from human plasma very low density lipoproteins.Brewer H.B. Jr., Shulman R., Herbert P., Ronan R., Wehrly K.J. Biol. Chem. 249:4975-4984(1974) An ABC of apolipoprotein C-III a clinically useful new cardiovascular risk factor?Chan D.C., Chen M.M., Ooi E.M., Watts G.F.Int. J. Clin. Pract. 62:799-809(2008) Enrichment of glycopeptides for glycan structure and attachment site identification.Nilsson J., Rueetschi U., Halim A., Hesse C., Carlsohn E., Brinkmalm G., Larson G.Nat. Methods 6:809-811(2009) Initial characterization of the human central proteome.Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17(2011) Apolipoprotein C-III and hepatic triglyceride-rich lipoprotein production.Yao Z., Wang Y.Curr. Opin. Lipidol. 23:206-212(2012) Identification of new apolipoprotein-CIII glycoforms with ultrahigh resolution MALDI-FTICR mass spectrometry of human sera.Nicolardi S., van der Burgt Y.E., Dragan I., Hensbergen P.J., Deelder A.M.J. Proteome Res. 12:2260-2268(2013) An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.J. Proteomics 96:253-262(2014) Molecular cloning of a human apoC-III variant Thr 74-->Ala 74 mutation prevents O-glycosylation.Maeda H., Hashimoto R.K., Oguro T., Hiraga S., Uzawa H.J. Lipid Res. 28:1405-1409(1987) Apolipoprotein C-III(Lys-58-->Glu) . Identification of an apolipoprotein C-III variant in a family with hyperalphalipoproteinemia.von Eckardstein A., Holz H., Sandkamp M., Weng W., Funke H., Assmann G.J. Clin. Invest. 87:1724-1731(1991)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
24.8 kDa
NCBI Official Full Name
apolipoprotein C-III
NCBI Official Synonym Full Names
apolipoprotein C-III
NCBI Official Symbol
APOC3
NCBI Official Synonym Symbols
HALP2; APOCIII
NCBI Protein Information
apolipoprotein C-III
UniProt Protein Name
Apolipoprotein C-III
UniProt Gene Name
APOC3
UniProt Synonym Gene Names
Apo-CIII; ApoC-III
UniProt Entry Name
APOC3_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The APOC3 apoc3 (Catalog #AAA114123) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 21-99aa; Full Length of Mature Protein. The amino acid sequence is listed below: SEAEDASLLS FMQGYMKHAT KTAKDALSSV QESQVAQQAR GWVTDGFSSL KDYWSTVKDK FSEFWDLDPE VRPTSAVAA. It is sometimes possible for the material contained within the vial of "Apolipoprotein C-III, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
