Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA18449_SDS_PAGE.png SDS-PAGE

Apolipoprotein E (Apoe) Recombinant Protein | Apoe recombinant protein

Recombinant Mouse Apolipoprotein E (Apoe)

Gene Names
Apoe; Apo-E; AI255918
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Apolipoprotein E (Apoe); N/A; Recombinant Mouse Apolipoprotein E (Apoe); Apoe recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
19-311aa; Full Length of Mature Protein
Sequence
EGEPEVTDQLEWQSNQPWEQALNRFWDYLRWVQTLSDQVQEELQSSQVTQELTALMEDTMTEVKAYKKELEEQLGPVAEETRARLGKEVQAAQARLGADMEDLRNRLGQYRNEVHTMLGQSTEEIRARLSTHLRKMRKRLMRDAEDLQKRLAVYKAGAREGAERGVSAIRERLGPLVEQGRQRTANLGAGAAQPLRDRAQAFGDRIRGRLEEVGNQARDRLEEVREHMEEVRSKMEEQTQQIRLQAEIFQARLKGWFEPIVEDMHRQWANLMEKIQASVATNPIITPVAQENQ
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

product-image-AAA18449_SDS_PAGE.png SDS-PAGE
Related Product Information for Apoe recombinant protein
Mediates the binding, internalization, and catabolism of lipoprotein particles. It can serve as a ligand for the LDL (apo B/E) receptor and for the specific apo-E receptor (chylomicron remnant) of hepatic tissues.
References
Structure and expression of mouse apolipoprotein E gene.Horiuchi K., Tajima S., Menju M., Yamamoto A.J. Biochem. 106:98-103(1989) Evolution of apolipoprotein E mouse sequence and evidence for an 11-nucleotide ancestral unit.Rajavashisth T.B., Kaptein J.S., Reue K.L., Lusis A.J.Proc. Natl. Acad. Sci. U.S.A. 82:8085-8089(1985) Neuropathological changes in scrapie and Alzheimer's disease are associated with increased expression of apolipoprotein E and cathepsin D in astrocytes.Diedrich J.F., Minnigan M., Carp R.I., Whitaker J.N., Race R., Frey W. II, Haase A.T.J. Virol. 65:4759-4768(1991) Mass spectral analysis of the apolipoproteins on mouse high density lipoproteins. Detection of post-translational modifications.Puppione D.L., Yam L.M., Bassilian S., Souda P., Castellani L.W., Schumaker V.N., Whitelegge J.P.Biochim. Biophys. Acta 1764:1363-1371(2006) Lubec G., Kang S.U.Submitted (APR-2007) to UniProtKB CD36 ligands promote sterile inflammation through assembly of a Toll-like receptor 4 and 6 heterodimer.Stewart C.R., Stuart L.M., Wilkinson K., van Gils J.M., Deng J., Halle A., Rayner K.J., Boyer L., Zhong R., Frazier W.A., Lacy-Hulbert A., El Khoury J., Golenbock D.T., Moore K.J.Nat. Immunol. 11:155-161(2010)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37.9
NCBI Official Full Name
apolipoprotein E
NCBI Official Synonym Full Names
apolipoprotein E
NCBI Official Symbol
Apoe
NCBI Official Synonym Symbols
Apo-E; AI255918
NCBI Protein Information
apolipoprotein E
UniProt Protein Name
Apolipoprotein E
UniProt Gene Name
Apoe
UniProt Synonym Gene Names
Apo-E
UniProt Entry Name
APOE_MOUSE

Similar Products

Product Notes

The Apoe apoe (Catalog #AAA18449) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 19-311aa; Full Length of Mature Protein. The amino acid sequence is listed below: EGEPEVTDQL EWQSNQPWEQ ALNRFWDYLR WVQTLSDQVQ EELQSSQVTQ ELTALMEDTM TEVKAYKKEL EEQLGPVAEE TRARLGKEVQ AAQARLGADM EDLRNRLGQY RNEVHTMLGQ STEEIRARLS THLRKMRKRL MRDAEDLQKR LAVYKAGARE GAERGVSAIR ERLGPLVEQG RQRTANLGAG AAQPLRDRAQ AFGDRIRGRL EEVGNQARDR LEEVREHMEE VRSKMEEQTQ QIRLQAEIFQ ARLKGWFEPI VEDMHRQWAN LMEKIQASVA TNPIITPVAQ ENQ . It is sometimes possible for the material contained within the vial of "Apolipoprotein E (Apoe), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.