Loading...

Skip to main content
SDS-PAGE

Aquaporin-4 (AQP4) Recombinant Protein | AQP4 recombinant protein

Recombinant Human Aquaporin-4 (AQP4), partial

Gene Names
AQP4; MIWC; WCH4
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Aquaporin-4 (AQP4); N/A; Recombinant Human Aquaporin-4 (AQP4), partial; Mercurial-insensitive water channel; MIWC WCH4; AQP4 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
253-323. Partial
Sequence
CPDVEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQVETDDLILKPGVVHVIDVDRGEEKKGKDQSGEVLSSV
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

SDS-PAGE
Related Product Information for AQP4 recombinant protein
Forms a water-specific channel. Osmoreceptor which regulates body water balance and mediates water flow within the central nervous system.
Product Categories/Family for AQP4 recombinant protein
References
cDNA cloning, gene organization, and chromosomal localization of a human mercurial insensitive water channel. Evidence for distinct transcriptional units.Yang B., Ma T., Verkman A.S.J. Biol. Chem. 270:22907-22913(1995) A water channel closely related to rat brain aquaporin 4 is expressed in acid- and pepsinogen-secretory cells of human stomach.Misaka T., Abe K., Iwabuchi K., Kusakabe Y., Ichinose M., Miki K., Emori Y., Arai S.FEBS Lett. 381:208-212(1996) The human AQP4 gene definition of the locus encoding two water channel polypeptides in brain.Lu M., Lee M.D., Smith B.L., Jung J.S., Agre P., Verdijk M.A.J., Merkx G., Rijss J.P.L., Deen P.M.T.Proc. Natl. Acad. Sci. U.S.A. 93:10908-10912(1996) DNA sequence and analysis of human chromosome 18.Nusbaum C., Zody M.C., Borowsky M.L., Kamal M., Kodira C.D., Taylor T.D., Whittaker C.A., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X., Abouelleil A., Allen N.R., Anderson S., Bloom T., Bugalter B., Butler J., Cook A., DeCaprio D., Engels R., Garber M., Gnirke A., Hafez N., Hall J.L., Norman C.H., Itoh T., Jaffe D.B., Kuroki Y., Lehoczky J., Lui A., Macdonald P., Mauceli E., Mikkelsen T.S., Naylor J.W., Nicol R., Nguyen C., Noguchi H., O'Leary S.B., Piqani B., Smith C.L., Talamas J.A., Topham K., Totoki Y., Toyoda A., Wain H.M., Young S.K., Zeng Q., Zimmer A.R., Fujiyama A., Hattori M., Birren B.W., Sakaki Y., Lander E.S.Nature 437:551-555(2005) Megalencephalic leukoencephalopathy with subcortical cysts protein 1 functionally cooperates with the TRPV4 cation channel to activate the response of astrocytes to osmotic stress dysregulation by pathological mutations.Lanciotti A., Brignone M.S., Molinari P., Visentin S., De Nuccio C., Macchia G., Aiello C., Bertini E., Aloisi F., Petrucci T.C., Ambrosini E.Hum. Mol. Genet. 21:2166-2180(2012) Crystal structure of human aquaporin 4 at 1.8 A and its mechanism of conductance.Ho J.D., Yeh R., Sandstrom A., Chorny I., Harries W.E., Robbins R.A., Miercke L.J., Stroud R.M.Proc. Natl. Acad. Sci. U.S.A. 106:7437-7442(2009)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
361
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
10 kDa
NCBI Official Full Name
aquaporin-4 isoform M1
NCBI Official Synonym Full Names
aquaporin 4
NCBI Official Symbol
AQP4
NCBI Official Synonym Symbols
MIWC; WCH4
NCBI Protein Information
aquaporin-4
UniProt Protein Name
Aquaporin-4
UniProt Gene Name
AQP4
UniProt Synonym Gene Names
AQP-4; MIWC
UniProt Entry Name
AQP4_HUMAN

Similar Products

Product Notes

The AQP4 aqp4 (Catalog #AAA18480) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 253-323. Partial. The amino acid sequence is listed below: CPDVEFKRRF KEAFSKAAQQ TKGSYMEVED NRSQVETDDL ILKPGVVHVI DVDRGEEKKG KDQSGEVLSS V. It is sometimes possible for the material contained within the vial of "Aquaporin-4 (AQP4), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.