Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201169_WB13.jpg WB (Western Blot) (WB Suggested Anti-AQP4 AntibodyTitration: 1.0 ug/mlPositive Control: MDA-MB-435S Whole CellAQP4 is strongly supported by BioGPS gene expression data to be expressed in Human MDA-MB435 cells)

Rabbit AQP4 Polyclonal Antibody | anti-AQP4 antibody

AQP4 antibody - C-terminal region

Average rating 0.0
No ratings yet
Gene Names
AQP4; MIWC; WCH4
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Applications
Western Blot
Purity
Affinity Purified
Synonyms
AQP4, Antibody; AQP4 antibody - C-terminal region; anti-AQP4 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QQTKGSYMEVEDNRSQVETDDLILKPGVVHVIDVDRGEEKKGKDQSGEVL
Sequence Length
301
Applicable Applications for anti-AQP4 antibody
WB (Western Blot)
Homology
Cow: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%; Sheep: 93%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-AQP4 AntibodyTitration: 1.0 ug/mlPositive Control: MDA-MB-435S Whole CellAQP4 is strongly supported by BioGPS gene expression data to be expressed in Human MDA-MB435 cells)

product-image-AAA201169_WB13.jpg WB (Western Blot) (WB Suggested Anti-AQP4 AntibodyTitration: 1.0 ug/mlPositive Control: MDA-MB-435S Whole CellAQP4 is strongly supported by BioGPS gene expression data to be expressed in Human MDA-MB435 cells)

WB (Western Blot)

(Host: MouseTarget Name: AQP4Sample Tissue: Mouse HeartAntibody Dilution: 1ug/ml)

product-image-AAA201169_WB15.jpg WB (Western Blot) (Host: MouseTarget Name: AQP4Sample Tissue: Mouse HeartAntibody Dilution: 1ug/ml)
Related Product Information for anti-AQP4 antibody
This is a rabbit polyclonal antibody against AQP4. It was validated on Western Blot

Target Description: This gene encodes a member of the aquaporin family of intrinsic membrane proteins that function as water-selective channels in the plasma membranes of many cells. The encoded protein is the predominant aquaporin found in brain. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Product Categories/Family for anti-AQP4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
361
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32kDa
NCBI Official Full Name
aquaporin-4 isoform M1
NCBI Official Synonym Full Names
aquaporin 4
NCBI Official Symbol
AQP4
NCBI Official Synonym Symbols
MIWC; WCH4
NCBI Protein Information
aquaporin-4
UniProt Protein Name
Aquaporin-4
UniProt Gene Name
AQP4
UniProt Synonym Gene Names
AQP-4; MIWC
UniProt Entry Name
AQP4_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The AQP4 aqp4 (Catalog #AAA201169) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The AQP4 antibody - C-terminal region reacts with Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's AQP4 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the AQP4 aqp4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QQTKGSYMEV EDNRSQVETD DLILKPGVVH VIDVDRGEEK KGKDQSGEVL. It is sometimes possible for the material contained within the vial of "AQP4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.