Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA235197_SDS_PAGE15.jpg SDS-PAGE

ATP synthase subunit beta, mitochondrial (ATP5B) Recombinant Protein | ATP5B recombinant protein

Recombinant Human ATP synthase subunit beta, mitochondrial (ATP5B), partial

Average rating 0.0
No ratings yet
Gene Names
ATP5F1B; ATP5B; ATPMB; ATPSB; HEL-S-271
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
ATP synthase subunit beta, mitochondrial (ATP5B); N/A; Recombinant Human ATP synthase subunit beta, mitochondrial (ATP5B), partial; ATP5B recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
230-529. Partial
Sequence
YSVFAGVGERTREGNDLYHEMIESGVINLKDATSKVALVYGQMNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRAIAELGIYPAVDPLDSTSRIMDPNIVGSEHYDVARGVQKILQDYKSLQDIIAILGMDELSEEDKLTVSRARKIQRFLSQPFQVAEVFTGHMGKLVPLKETIKGFQQILAGEYDHLPEQAFYMVGPIEEAVAKADKLAEEHSS
Organism
Homo sapiens (Human)
Tag Information
N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Production Note
Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our or email to for more details.
Preparation and Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C.
The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

SDS-PAGE

product-image-AAA235197_SDS_PAGE15.jpg SDS-PAGE
Related Product Information for ATP5B recombinant protein
Mitochondrial membrane ATP synthase (F1F0 ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F1 - containing the extramembraneous catalytic core, and F0 - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F1 is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Subunits alpha and beta form the catalytic core in F1. Rotation of the central stalk against the surrounding alpha3beta3 subunits leads to hydrolysis of ATP in three separate catalytic sites on the beta subunits.
Product Categories/Family for ATP5B recombinant protein
References
"The human ATP synthase beta subunit gene: sequence analysis, chromosome assignment, and differential expression." Neckelmann N., Warner C.K., Chung A., Kudoh J., Minoshima S., Fukuyama R., Maekawa M., Shimizu Y., Shimizu N., Liu J.D., Wallace D.C.Genomics 5:829-843 (1989)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
506
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52.8 kDa
NCBI Official Full Name
ATP synthase subunit beta, mitochondrial
NCBI Official Synonym Full Names
ATP synthase F1 subunit beta
NCBI Official Symbol
ATP5F1B
NCBI Official Synonym Symbols
ATP5B; ATPMB; ATPSB; HEL-S-271
NCBI Protein Information
ATP synthase subunit beta, mitochondrial
UniProt Protein Name
ATP synthase subunit beta, mitochondrial
UniProt Gene Name
ATP5B
UniProt Synonym Gene Names
ATPMB; ATPSB

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The ATP5B atp5b (Catalog #AAA235197) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 230-529. Partial with tag N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged. The amino acid sequence is listed below: YSVFAGVGER TREGNDLYHE MIESGVINLK DATSKVALVY GQMNEPPGAR ARVALTGLTV AEYFRDQEGQ DVLLFIDNIF RFTQAGSEVS ALLGRIPSAV GYQPTLATDM GTMQERITTT KKGSITSVQA IYVPADDLTD PAPATTFAHL DATTVLSRAI AELGIYPAVD PLDSTSRIMD PNIVGSEHYD VARGVQKILQ DYKSLQDIIA ILGMDELSEE DKLTVSRARK IQRFLSQPFQ VAEVFTGHMG KLVPLKETIK GFQQILAGEY DHLPEQAFYM VGPIEEAVAK ADKLAEEHSS. It is sometimes possible for the material contained within the vial of "ATP synthase subunit beta, mitochondrial (ATP5B), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.