SDS-PAGE
ATP synthase subunit delta, mitochondrial (ATP5D) Recombinant Protein | ATP5D recombinant protein
Recombinant Human ATP synthase subunit delta, mitochondrial (ATP5D)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
ATP synthase subunit delta, mitochondrial (ATP5D); N/A; Recombinant Human ATP synthase subunit delta, mitochondrial (ATP5D); F-ATPase delta subunit; ATP5D recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
23-168. Full Length of Mature Protein
Sequence
AEAAAAPAAASGPNQMSFTFASPTQVFFNGANVRQVDVPTLTGAFGILAAHVPTLQVLRPGLVVVHAEDGTTSKYFVSSGSIAVNADSSVQLLAEEAVTLDMLDLGAAKANLEKAQAELVGTADEATRAEIQIRIEANEALVKALE
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
SDS-PAGE
SDS-PAGE
Related Product Information for ATP5D recombinant protein
Mitochondrial membrane ATP synthase (F1F0 ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F1 - containing the extramembraneous catalytic core, and F0 - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP turnover in the catalytic domain of F1 is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F1 domain and of the central stalk which is part of the complex rotary element. Rotation of the central stalk against the surrounding alpha3beta3 subunits leads to hydrolysis of ATP in three separate catalytic sites on the beta subunits.
Product Categories/Family for ATP5D recombinant protein
References
Molecular cloning of an import precursor of the delta-subunit of the human mitochondrial ATP synthase complex.Jordan E.M., Breen G.A.M.Biochim. Biophys. Acta 1130:123-126(1992)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
17 kDa
NCBI Official Full Name
ATP synthase subunit delta, mitochondrial
NCBI Official Synonym Full Names
ATP synthase, H+ transporting, mitochondrial F1 complex, delta subunit
NCBI Official Symbol
ATP5D
NCBI Protein Information
ATP synthase subunit delta, mitochondrial
UniProt Protein Name
ATP synthase subunit delta, mitochondrial
UniProt Gene Name
ATP5D
UniProt Entry Name
ATPD_HUMAN
Similar Products
Product Notes
The ATP5D atp5d (Catalog #AAA18407) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 23-168. Full Length of Mature Protein. The amino acid sequence is listed below: AEAAAAPAAA SGPNQMSFTF ASPTQVFFNG ANVRQVDVPT LTGAFGILAA HVPTLQVLRP GLVVVHAEDG TTSKYFVSSG SIAVNADSSV QLLAEEAVTL DMLDLGAAKA NLEKAQAELV GTADEATRAE IQIRIEANEA LVKALE . It is sometimes possible for the material contained within the vial of "ATP synthase subunit delta, mitochondrial (ATP5D), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.