Branched-chain-amino-acid aminotransferase, cytosolic (Bcat1) Recombinant Protein | Bcat1 recombinant protein
Recombinant Mouse Branched-chain-amino-acid aminotransferase, cytosolic (Bcat1)
Gene Names
Bcat1; BCATc; Eca39
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Branched-chain-amino-acid aminotransferase, cytosolic (Bcat1); N/A; Recombinant Mouse Branched-chain-amino-acid aminotransferase, cytosolic (Bcat1); Bcat1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-386aa; Full Length
Sequence
MKDCSNGCSAPFAGERGSEEVAETFRAKDLIITPATVLKEKPDPDSLVFGATFTDHMLTVEWSSASGWEKPHIKPFGNLPIHPAASVLHYAVELFEGLKAFRGVDNKIRLFRPDLNMDRMCRSAVRTTLPMFDKEELLKCILQLLQIDQEWVPYSTSASLYIRPTFIGTEPSLGVKKPSKALLFVILSPVGPYFSSGSFTPVSLWANPKYIRAWKGGTGDCKMGGNYGASLLAQCEAVENGCQQVLWLYGKDNQITEVGTMNLFLYWINEDGEEELATPPLDGIILPGVTRQSILELAQQWGEFKVCERHLTMDDLATALEGNRVKEMFGSGTACVVCPVSDILYKGQMLHIPTMENGPKLASRILGKLTDIQYGRVESDWTIELP
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Bcat1 recombinant protein
This gene encodes the cytosolic form of the enzyme branched-chain amino acid transaminase. This enzyme catalyzes the reversible transamination of branched-chain alpha-keto acids to branched-chain L-amino acids essential for cell growth. Two different clinical disorders have been attributed to a defect of branched-chain amino acid transamination: hypervalinemia and hyperleucine-isoleucinemia. As there is also a gene encoding a mitochondrial form of this enzyme, mutations in either gene may contribute to these disorders.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
46.4 kDa
NCBI Official Full Name
branched-chain-amino-acid aminotransferase, cytosolic isoform 2
NCBI Official Synonym Full Names
branched chain aminotransferase 1, cytosolic
NCBI Official Symbol
Bcat1
NCBI Official Synonym Symbols
BCATc; Eca39
NCBI Protein Information
branched-chain-amino-acid aminotransferase, cytosolic
UniProt Protein Name
Branched-chain-amino-acid aminotransferase, cytosolic
UniProt Gene Name
Bcat1
UniProt Synonym Gene Names
Eca39; BCAT(c)
Similar Products
Product Notes
The Bcat1 bcat1 (Catalog #AAA113325) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-386aa; Full Length. The amino acid sequence is listed below: MKDCSNGCSA PFAGERGSEE VAETFRAKDL IITPATVLKE KPDPDSLVFG ATFTDHMLTV EWSSASGWEK PHIKPFGNLP IHPAASVLHY AVELFEGLKA FRGVDNKIRL FRPDLNMDRM CRSAVRTTLP MFDKEELLKC ILQLLQIDQE WVPYSTSASL YIRPTFIGTE PSLGVKKPSK ALLFVILSPV GPYFSSGSFT PVSLWANPKY IRAWKGGTGD CKMGGNYGAS LLAQCEAVEN GCQQVLWLYG KDNQITEVGT MNLFLYWINE DGEEELATPP LDGIILPGVT RQSILELAQQ WGEFKVCERH LTMDDLATAL EGNRVKEMFG SGTACVVCPV SDILYKGQML HIPTMENGPK LASRILGKLT DIQYGRVESD WTIELP. It is sometimes possible for the material contained within the vial of "Branched-chain-amino-acid aminotransferase, cytosolic (Bcat1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.