Loading...

Skip to main content
SDS-PAGE

Beta-lactamase TEM (bla) Recombinant Protein | bla recombinant protein

Recombinant Escherichia coli Beta-lactamase TEM (bla)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Beta-lactamase TEM (bla); N/A; Recombinant Escherichia coli Beta-lactamase TEM (bla); IRT-4; Penicillinase; TEM-1; TEM-16/CAZ-7; TEM-2; TEM-24/CAZ-6; TEM-3; TEM-4; TEM-5; TEM-6; TEM-8/CAZ-2; bla recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
24-286aa; Full Length of Mature Protein
Sequence
HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

SDS-PAGE
Related Product Information for bla recombinant protein
T-type are the most prevalent beta-lactamases in enterobacteria; they hydrolyze the beta-lactam bond in susceptible beta-lactam antibiotics, thus conferring resistance to penicillins and cephalosporins. T-3 and T-4 are capable of hydrolyzing cefotaxime and ceftazidime. T-5 is capable of hydrolyzing ceftazidime. T-6 is capable of hydrolyzing ceftazidime and aztreonam. T-8/CAZ-2, T-16/CAZ-7 and T-24/CAZ-6 are markedly active against ceftazidime. IRT-4 shows resistance to beta-lactamase inhibitors.
References
Nucleotide sequence of the ampicillin resistance gene of Escherichia coli plasmid pBR322.Sutcliffe J.G.Proc. Natl. Acad. Sci. U.S.A. 75:3737-3741(1978) Complete nucleotide sequence of the Escherichia coli plasmid pBR322.Sutcliffe J.G.Cold Spring Harb. Symp. Quant. Biol. 43:77-90(1979) DNA replication of the resistance plasmid R100 and its control.Ohtsubo H., Ryder T.B., Maeda Y., Armstrong K., Ohtsubo E.Adv. Biophys. 21:115-133(1986) Partial amino acid sequence of penicillinase coded by Escherichia coli plasmid R6K.Ambler R.P., Scott G.K.Proc. Natl. Acad. Sci. U.S.A. 75:3732-3736(1978) The TEM-3 beta-lactamase, which hydrolyzes broad-spectrum cephalosporins, is derived from the TEM-2 penicillinase by two amino acid substitutions.Sougakoff W., Goussard S., Courvalin P.FEMS Microbiol. Lett. 56:343-348(1988) A new example of physical linkage between Tn1 and Tn21 the antibiotic multiple-resistance region of plasmid pCFF04 encoding extended-spectrum beta-lactamase TEM-3.Mabilat C., Lourencao-Vital J., Goussard S., Courvalin P.Mol. Gen. Genet. 235:113-121(1992) Characterization of the plasmid genes blaT-4 and blaT-5 which encode the broad-spectrum beta-lactamases TEM-4 and TEM-5 in enterobacteriaceae.Sougakoff W., Petit A., Goussard S., Sirot D., Bure A., Courvalin P.Gene 78:339-348(1989) An IS1-like element is responsible for high-level synthesis of extended-spectrum beta-lactamase TEM-6 in Enterobacteriaceae.Goussard S., Sougakoff W., Mabilat C., Bauernfeind A., Courvalin P.J. Gen. Microbiol. 137:2681-2687(1991) Nucleotide sequences of CAZ-2, CAZ-6, and CAZ-7 beta-lactamase genes.Chanal C., Poupart M.C., Sirot D., Labia R., Sirot J., Cluzel R.Antimicrob. Agents Chemother. 36:1817-1820(1992) Characterization and amino acid sequence of IRT-4, a novel TEM-type enzyme with a decreased susceptibility to beta-lactamase inhibitors.Brun T., Peduzzi J., Canica M.M., Paul G., Nevot P., Barthelemy M., Labia R.FEMS Microbiol. Lett. 120:111-117(1994) Beta-lactamase TEM1 of E. coli. Crystal structure determination at 2.5-A resolution.Jelsch C., Lenfant F., Masson J.-M., Samama J.-P.FEBS Lett. 299:135-142(1992) Crystal structure of Escherichia coli TEM1 beta-lactamase at 1.8-A resolution.Jelsch C., Mourey L., Masson J.-M., Samama J.-P.Proteins 16:364-383(1993) A potent new mode of beta-lactamase inhibition revealed by the 1.7 A X-ray crystallographic structure of the TEM-1-BLIP complex.Strynadka N.C.J., Jensen S.E., Alzari P.M., James M.N.G.Nat. Struct. Biol. 3:290-297(1996) Crystal structure of an acylation transition-state analog of the TEM-1 beta-lactamase. Mechanistic implications for class A beta-lactamases.Maveyraud L., Pratt R.F., Samama J.-P.Biochemistry 37:2622-2628(1998) X-ray structure of the Asn276Asp variant of the Escherichia coli TEM-1 beta-lactamase direct observation of electrostatic modulation in resistance to inactivation by clavulanic acid.Swaren P., Golemi D., Cabantous S., Bulychev A., Maveyraud L., Mobashery S., Samama J.-P.Biochemistry 38:9570-9576(1999)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30.9 kDa
NCBI Official Full Name
beta-lactamase (plasmid)
NCBI Official Symbol
pIGAL1_03
NCBI Protein Information
beta-lactamase
UniProt Protein Name
Beta-lactamase TEM
UniProt Gene Name
bla
UniProt Entry Name
BLAT_ECOLX

Similar Products

Product Notes

The bla bla (Catalog #AAA18712) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 24-286aa; Full Length of Mature Protein. The amino acid sequence is listed below: HPETLVKVKD AEDQLGARVG YIELDLNSGK ILESFRPEER FPMMSTFKVL LCGAVLSRVD AGQEQLGRRI HYSQNDLVEY SPVTEKHLTD GMTVRELCSA AITMSDNTAA NLLLTTIGGP KELTAFLHNM GDHVTRLDRW EPELNEAIPN DERDTTMPAA MATTLRKLLT GELLTLASRQ QLIDWMEADK VAGPLLRSAL PAGWFIADKS GAGERGSRGI IAALGPDGKP SRIVVIYTTG SQATMDERNR QIAEIGASLI KHW . It is sometimes possible for the material contained within the vial of "Beta-lactamase TEM (bla), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.