Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Cart Login
product-image-AAA18777_SDS_PAGE.jpg
SDS-PAGE

Carbapenem-hydrolyzing beta-lactamase KPC (bla) Recombinant Protein | bla recombinant protein

Recombinant Klebsiella oxytoca Carbapenem-hydrolyzing beta-lactamase KPC (bla)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Carbapenem-hydrolyzing beta-lactamase KPC (bla); N/A; Recombinant Klebsiella oxytoca Carbapenem-hydrolyzing beta-lactamase KPC (bla); Carbapenem-hydrolyzing beta-lactamase KPC-2; bla recombinant protein
Ordering
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
25-293aa; Full Length of Mature Protein
Sequence
LTNLVAEPFAKLEQDFGGSIGVYAMDTGSGATVSYRAEERFPLCSSFKGFLAAAVLARSQQQAGLLDTPIRYGKNALVPWSPISEKYLTTGMTVAELSAAAVQYSDNAAANLLLKELGGPAGLTAFMRSIGDTTFRLDRWELELNSAIPGDARDTSSPRAVTESLQKLTLGSALAAPQRQQFVDWLKGNTTGNHRIRAAVPADWAVGDKTGTCGVYGTANDYAVVWPTGRAPIVLAVYTRAPNKDDKHSEAVIAAAARLALEGLGVNGQ
Species
Klebsiella oxytoca
Buffer
0.2 um Sterile Filtered PBS, pH 7.4, 20% glycerol
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for bla recombinant protein
Hydrolyzes carbapenems, penicillins, cephalosporins and aztreonam with varying efficiency.
References
"Carbapenem-resistant strain of Klebsiella oxytoca harboring carbapenem-hydrolyzing beta-lactamase KPC-2." Yigit H., Queenan A.M., Rasheed J.K., Biddle J.W., Domenech-Sanchez A., Alberti S., Bush K., Tenover F.C. Antimicrob. Agents Chemother. 47:3881-3889(2003)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30.5 kDa
NCBI Official Full Name
MULTISPECIES: carbapenem-hydrolyzing class A beta-lactamase KPC-2
NCBI Official Symbol
CFNIH1_RS25375
NCBI Protein Information
carbapenem-hydrolyzing class A beta-lactamase KPC-2
UniProt Protein Name
Carbapenem-hydrolyzing beta-lactamase KPC
UniProt Gene Name
bla
UniProt Synonym Gene Names
kpc; kpc2
UniProt Entry Name
BLKPC_KLEOX

Similar Products

product-image-AAA18777_SDS_PAGE.jpg

bla Recombinant Protein

Host: E Coli or Yeast or Baculovirus or Mammalian Cell
Reactivity: n/a
Apps: n/a
product-image-AAA18712_SDS_PAGE.png

bla Recombinant Protein

Host: E Coli or Yeast or Baculovirus or Mammalian Cell
Reactivity: n/a
Apps: n/a
product-image-AAA18639_SDS_PAGE.png

bla Recombinant Protein

Host: E Coli or Yeast or Baculovirus or Mammalian Cell
Reactivity: n/a
Apps: n/a
product-image-AAA18707_SDS_PAGE.png

ampC Recombinant Protein

Host: E Coli or Yeast or Baculovirus or Mammalian Cell
Reactivity: n/a
Apps: n/a
product-image-AAA15920_SDS_PAGE.jpg

NDM-1 Recombinant Protein

Host: E Coli or Yeast or Baculovirus or Mammalian Cell
Reactivity: n/a
Apps: n/a
product-image-AAA13325_SC.jpg

Beta-APP42 ELISA Kit

Host: n/a
Reactivity: Human
Apps: n/a
product-image-AAA22564_SC.jpg

beta-GUS ELISA Kit

Host: n/a
Reactivity: Canine
Apps: n/a
product-image-AAA17699_SC.jpg

beta-CTx ELISA Kit

Host: n/a
Reactivity: Human
Apps: n/a
product-image-AAA15147_SC.png

beta-TG ELISA Kit

Host: n/a
Reactivity: Human
Apps: n/a
product-image-AAA16968_SC.jpg

beta-OHB ELISA Kit

Host: n/a
Reactivity: Sheep
Apps: n/a
product-image-AAA15746_SC.png

beta-TG ELISA Kit

Host: n/a
Reactivity: Pig
Apps: n/a
product-image-AAA27784_IP6.png

Beta-Tubulin Recombinant Antibody

Host: Rabbit
Reactivity: Human
Apps: Functional Assay, Western Blot, Functional Assay, Immunohistochemistry, Functional Assay, Immunocytochemistry, Immunofluorescence, Functional Assay, Immunoprecipitation
product-image-AAA11156_SC.jpg

beta-DF ELISA Kit

Host: n/a
Reactivity: Mouse
Apps: n/a
product-image-AAA21902_SC.jpg

beta-CTx ELISA Kit

Host: n/a
Reactivity: Rat
Apps: n/a
product-image-AAA17569_SC.jpg

beta-EP ELISA Kit

Host: n/a
Reactivity: Rat
Apps: n/a
product-image-AAA22515_SC.jpg

beta-MSH ELISA Kit

Host: n/a
Reactivity: Human
Apps: n/a
product-image-AAA15602_SC.png

beta-TG ELISA Kit

Host: n/a
Reactivity: Rabbit
Apps: n/a
product-image-AAA18951_SC.jpg

ER-beta ELISA Kit

Host: n/a
Reactivity: Mouse
Apps: n/a
product-image-AAA16147_SC.jpg

IFN-beta ELISA Kit

Host: n/a
Reactivity: Mouse
Apps: n/a

Product Notes

The bla bla (Catalog #AAA18777) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 25-293aa; Full Length of Mature Protein. The amino acid sequence is listed below: LTNLVAEPFA KLEQDFGGSI GVYAMDTGSG ATVSYRAEER FPLCSSFKGF LAAAVLARSQ QQAGLLDTPI RYGKNALVPW SPISEKYLTT GMTVAELSAA AVQYSDNAAA NLLLKELGGP AGLTAFMRSI GDTTFRLDRW ELELNSAIPG DARDTSSPRA VTESLQKLTL GSALAAPQRQ QFVDWLKGNT TGNHRIRAAV PADWAVGDKT GTCGVYGTAN DYAVVWPTGR APIVLAVYTR APNKDDKHSE AVIAAAARLA LEGLGVNGQ . It is sometimes possible for the material contained within the vial of "Carbapenem-hydrolyzing beta-lactamase KPC (bla), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.