B-type Natriuretic Peptide | BNP peptide
Human B-type Natriuretic Protein
Gene Names
NPPB; BNP
Purity
Greater than 95.0% as determined by RP-HPLC.
Synonyms
B-type Natriuretic; N/A; Human B-type Natriuretic Protein; BNP Human; B-type Natriuretic Peptide Human; NPPB; Natriuretic Peptide Precursor B; BNP; B-type Natriuretic Peptide; BNP peptide
Purity/Purification
Greater than 95.0% as determined by RP-HPLC.
Form/Format
The protein was lyophilized without additives.
Sequence
SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH
Sequence Length
134
Solubility
It is recommended to reconstitute the lyophilized B-type Natriuretic Peptide in sterile 18M Omega -cm H2O not less than 100 ug/ml, which can then be further diluted to other aqueous solutions.
Physical Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Preparation and Storage
Lyophilized B-type Natriuretic Peptide although stable at room temperature for 3 weeks, should be stored desiccated below -18 degree C. Upon reconstitution B-type Natriuretic Peptide should be stored at 4 degree C between 2-7 days and for future use below -18 degree C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
Related Product Information for BNP peptide
Description: B-type Natriuretic Peptide Human is a polypeptide chain containing 32 amino acids and having a molecular mass of 3464 Dalton. The molecular formula is:C143H244N50O42S 4.
Product Categories/Family for BNP peptide
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
NCBI Official Full Name
natriuretic peptides B preproprotein
NCBI Official Synonym Full Names
natriuretic peptide B
NCBI Official Symbol
NPPB
NCBI Official Synonym Symbols
BNP
NCBI Protein Information
natriuretic peptides B; brain type natriuretic peptide; gamma-brain natriuretic peptide; natriuretic peptide precursor B; natriuretic protein
UniProt Protein Name
Natriuretic peptides B
UniProt Gene Name
NPPB
UniProt Synonym Gene Names
BNP(1-32); BNP-32
UniProt Entry Name
ANFB_HUMAN
Similar Products
Product Notes
The BNP nppb (Catalog #AAA38179) is a Peptide and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: SPKMVQGSGC FGRKMDRISS SSGLGCKVLR RH. It is sometimes possible for the material contained within the vial of "B-type Natriuretic, Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.