Botulinum neurotoxin type A Recombinant Protein | botA recombinant protein
Recombinant Clostridium botulinum Botulinum neurotoxin type A
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Botulinum neurotoxin type A; N/A; Recombinant Clostridium botulinum Botulinum neurotoxin type A; Bontoxilysin-A; BOTOX; botA recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-436aa; partial
Sequence
MPFVNKQFNYKDPVNGVDIAYIKIPNVGQMQPVKAFKIHNKIWVIPERDTFTNPEEGDLNPPPEAKQVPVSYYDSTYLSTDNEKDNYLKGVTKLFERIYSTDLGRMLLTSIVRGIPFWGGSTIDTELKVIDTNCINVIQPDGSYRSEELNLVIIGPSADIIQFECKSFGHEVLNLTRNGYGSTQYIRFSPDFTFGFEESLEVDTNPLLGAGKFATDPAVTLAHELIHAGHRLYGIAINPNRVFKVNTNAYYEMSGLEVSFEELRTFGGHDAKFIDSLQENEFRLYYYNKFKDIASTLNKAKSIVGTTASLQYMKNVFKEKYLLSEDTSGKFSVDKLKFDKLYKMLTEIYTEDNFVKFFKVLNRKTYLNFDKAVFKINIVPKVNYTIYDGFNLRNTNLAANFNGQNTEINNMNFTKLKNFTGLFEFYKLLCVRGIIT
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Related Product Information for botA recombinant protein
Inhibits acetylcholine release. The botulinum toxin binds with high affinity to peripheral neuronal presynaptic membrane to the secretory vesicle protein SV2. It binds directly to the largest luminal loop of SV2A, SV2B and SV2C. It is then internalized by receptor-mediated endocytosis. The C-terminus of the heavy chain (H) is responsible for the adherence of the toxin to the cell surface while the N-terminus mediates transport of the light chain from the endocytic vesicle to the cytosol. After translocation, the light chain (L) hydrolyzes the 197-Gln-|-Arg-198 bond in SNAP-25, thereby blocking neurotransmitter release. Inhibition of acetylcholine release results in flaccid paralysis, with frequent heart or respiratory failure.
References
The complete amino acid sequence of the Clostridium botulinum type A neurotoxin, deduced by nucleotide sequence analysis of the encoding gene.Thompson D.E., Brehm J.K., Oultram J.D., Swinfield T.-J., Shone C.C., Atkinson T., Melling J., Minton N.P.Eur. J. Biochem. 189:73-81(1990)
The complete sequence of botulinum neurotoxin type A and comparison with other clostridial neurotoxins.Binz T., Kurazono H., Wille M., Frevert J., Wernars K., Niemann H.J. Biol. Chem. 265:9153-9158(1990)
Organization and phylogenetic interrelationships of genes encoding components of the botulinum toxin complex in proteolytic Clostridium botulinum types A, B, and F
evidence of chimeric sequences in the gene encoding the nontoxic nonhemagglutinin component.East A.K., Bhandari M., Stacey J.M., Campbell K.D., Collins M.D.Int. J. Syst. Bacteriol. 46:1105-1112(1996)
Molecular characterization of two forms of nontoxic-nonhemagglutinin components of Clostridium botulinum type A progenitor toxins.Fujita R., Fujinaga Y., Inoue K., Nakajima H., Kumon H., Oguma K.FEBS Lett. 376:41-44(1995)
Partial amino acid sequence of the heavy and light chains of botulinum neurotoxin type A.Schmidt J.J., Sartymoorthy V., Dasgupta B.R.Biochem. Biophys. Res. Commun. 119:900-904(1984)
Partial sequence of the light chain of botulinum neurotoxin type A.Dasgupta B.R., Foley J., Niece R.Biochemistry 26:4162-4162(1987)
Botulinum neurotoxin type A
sequence of amino acids at the N-terminus and around the nicking site.Dasgupta B.R., Dekleva M.L.Biochimie 72:661-664(1990)
Botulinum neurotoxin type A
cleavage of the heavy chain into two halves and their partial sequences.Sathymoorthy V., Dasgupta B.R., Foley J., Niece R.L.Arch. Biochem. Biophys. 266:142-151(1988)
Inactivation of Clostridium botulinum type A neurotoxin by trypsin and purification of two tryptic fragments. Proteolytic action near the COOH-terminus of the heavy subunit destroys toxin-binding activity.Shone C.C., Hambleton P., Melling J.Eur. J. Biochem. 151:75-82(1985)
Botulinum neurotoxins serotypes A and E cleave SNAP-25 at distinct COOH-terminal peptide bonds.Schiavo G., Santtuci A., Dasgupta B.R., Mehta P.P., Jontes J., Benfenati F., Wilson M.C., Montecucco C.FEBS Lett. 335:99-103(1993)
Site-directed mutagenesis identifies active-site residues of the light chain of botulinum neurotoxin type a.Rigoni M., Caccin P., Johnson E.A., Montecucco C., Rossetto O.Biochem. Biophys. Res. Commun. 288:1231-1237(2001)
SV2 is the protein receptor for botulinum neurotoxin A.Dong M., Yeh F., Tepp W.H., Dean C., Johnson E.A., Janz R., Chapman E.R.Science 312:592-596(2006)
Crystal structure of botulinum neurotoxin type A and implications for toxicity.Lacy D.B., Tepp W., Cohen A.C., Dasgupta B.R., Stevens R.C.Nat. Struct. Biol. 5:898-902(1998)
NCBI and Uniprot Product Information
NCBI GI #
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
52 kDa
NCBI Official Full Name
peptidase M27
UniProt Protein Name
Botulinum neurotoxin type A
UniProt Gene Name
botA
UniProt Synonym Gene Names
atx; bna; BoNT/A; BOTOX
UniProt Entry Name
BXA1_CLOBO
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The botA bota (Catalog #AAA18591) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-436aa; partial. The amino acid sequence is listed below: MPFVNKQFNY KDPVNGVDIA YIKIPNVGQM QPVKAFKIHN KIWVIPERDT FTNPEEGDLN PPPEAKQVPV SYYDSTYLST DNEKDNYLKG VTKLFERIYS TDLGRMLLTS IVRGIPFWGG STIDTELKVI DTNCINVIQP DGSYRSEELN LVIIGPSADI IQFECKSFGH EVLNLTRNGY GSTQYIRFSP DFTFGFEESL EVDTNPLLGA GKFATDPAVT LAHELIHAGH RLYGIAINPN RVFKVNTNAY YEMSGLEVSF EELRTFGGHD AKFIDSLQEN EFRLYYYNKF KDIASTLNKA KSIVGTTASL QYMKNVFKEK YLLSEDTSGK FSVDKLKFDK LYKMLTEIYT EDNFVKFFKV LNRKTYLNFD KAVFKINIVP KVNYTIYDGF NLRNTNLAAN FNGQNTEINN MNFTKLKNFT GLFEFYKLLC VRGIIT . It is sometimes possible for the material contained within the vial of "Botulinum neurotoxin type A, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
