SDS-PAGE
Complement C1q subcomponent subunit A Recombinant Protein | C1qa recombinant protein
Recombinant Rat Complement C1q subcomponent subunit A
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Complement C1q subcomponent subunit A; N/A; Recombinant Rat Complement C1q subcomponent subunit A; Rattus norvegicus (Rat); C1qa recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
23-245aa; Full Length of Mature Protein
Sequence
EDVCRAPNGKDGVAGIPGRPGRPGLKGERGEPGAAGIRTGIRGLKGDMGESGPPGKPGNVGFPGPTGPLGNSGPQGLKGVKGNPGNIRDQPRPAFSAIRQNPPTYGNVVVFDKVLTNQENPYQNRTGHFICAVPGFYYFTFQVISKWDLCLSIVSSSRGQPRNSLGFCDTNSKGLFQVLAGGTVLQLQRGDEVWIEKDPAKGRIYQGTEADSIFSGFLIFPSA
Species
Rat
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
SDS-PAGE
SDS-PAGE
Related Product Information for C1qa recombinant protein
C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca2+-dependent C1r2C1s2 proenzyme complex, and efficient activation of C1 takes place on interaction of the globular heads of C1q with the Fc regions of IgG or IgM antibody present in immune complexes.
Product Categories/Family for C1qa recombinant protein
References
"Rapid isolation and biochemical characterization of rat C1 and C1q." Wing M.G., Seilly D.J., Bridgman D.J., Harrison R.A. Mol. Immunol. 30:433-440(1993)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
39.6 kDa
NCBI Official Full Name
complement C1q subcomponent subunit A
NCBI Official Synonym Full Names
complement component 1, q subcomponent, A chain
NCBI Official Symbol
C1qa
NCBI Protein Information
complement C1q subcomponent subunit A
UniProt Protein Name
Complement C1q subcomponent subunit A
UniProt Gene Name
C1qa
UniProt Entry Name
C1QA_RAT
Similar Products
Product Notes
The C1qa c1qa (Catalog #AAA113472) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 23-245aa; Full Length of Mature Protein. The amino acid sequence is listed below: EDVCRAPNGK DGVAGIPGRP GRPGLKGERG EPGAAGIRTG IRGLKGDMGE SGPPGKPGNV GFPGPTGPLG NSGPQGLKGV KGNPGNIRDQ PRPAFSAIRQ NPPTYGNVVV FDKVLTNQEN PYQNRTGHFI CAVPGFYYFT FQVISKWDLC LSIVSSSRGQ PRNSLGFCDT NSKGLFQVLA GGTVLQLQRG DEVWIEKDPA KGRIYQGTEA DSIFSGFLIF PSA. It is sometimes possible for the material contained within the vial of "Complement C1q subcomponent subunit A, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.