Caveolin-1 Recombinant Protein | CAV1 recombinant protein

Recombinant Dog Caveolin-1

Cat. Num. AAA113188

• Gene Names: CAV1; caveolin 1
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Caveolin-1; N/A; Recombinant Dog Caveolin-1; Vesicular integral-membrane protein VIP21; CAV1 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-178aa; Isoform Alpha
• Sequence: MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMAEEMSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTFCDPFFEAVGKIFSNIRINMQKET
• Sequence Length: 178

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for CAV1 recombinant protein

Involved in the costimulatory signal essential for T-cell receptor (TCR)-mediated T-cell activation. Its binding to DPP4 induces T-cell proliferation and NF-kappa-B activation in a T-cell receptor/CD3-dependent manner. May act as a scaffolding protein within caveolar membranes. Interacts directly with G-protein alpha subunits and can functionally regulate their activity. Recruits CTNNB1 to caveolar membranes and may regulate CTNNB1-mediated signaling through the Wnt pathway.

References

VIP21, a 21-kD membrane protein is an integral component of trans-Golgi-network-derived transport vesicles.Kurzchalia T.V., Dupree P., Parton R.G., Kellner R., Virta H., Lehnert M., Simons K.J. Cell Biol. 118:1003-1014(1992) Signal transducing molecules and glycosyl-phosphatidylinositol-linked proteins form a caveolin-rich insoluble complex in MDCK cells.Sargiacomo M., Sudol M., Tang Z., Lisanti M.P.J. Cell Biol. 122:789-807(1993) Comparative analyses of multi-species sequences from targeted genomic regions.Thomas J.W., Touchman J.W., Blakesley R.W., Bouffard G.G., Beckstrom-Sternberg S.M., Margulies E.H., Blanchette M., Siepel A.C., Thomas P.J., McDowell J.C., Maskeri B., Hansen N.F., Schwartz M.S., Weber R.J., Kent W.J., Karolchik D., Bruen T.C., Bevan R., Cutler D.J., Schwartz S., Elnitski L., Idol J.R., Prasad A.B., Lee-Lin S.-Q., Maduro V.V.B., Summers T.J., Portnoy M.E., Dietrich N.L., Akhter N., Ayele K., Benjamin B., Cariaga K., Brinkley C.P., Brooks S.Y., Granite S., Guan X., Gupta J., Haghighi P., Ho S.-L., Huang M.C., Karlins E., Laric P.L., Legaspi R., Lim M.J., Maduro Q.L., Masiello C.A., Mastrian S.D., McCloskey J.C., Pearson R., Stantripop S., Tiongson E.E., Tran J.T., Tsurgeon C., Vogt J.L., Walker M.A., Wetherby K.D., Wiggins L.S., Young A.C., Zhang L.-H., Osoegawa K., Zhu B., Zhao B., Shu C.L., De Jong P.J., Lawrence C.E., Smit A.F., Chakravarti A., Haussler D., Green P., Miller W., Green E.D.Nature 424:788-793(2003) Caveolae and sorting in the trans-Golgi network of epithelial cells.Dupree P., Parton R.G., Raposo G., Kurzchalia T.V., Simons K.EMBO J. 12:1597-1605(1993) Oligomeric structure of caveolin implications for caveolae membrane organization.Sargiacomo M., Scherer P.E., Tang Z., Kubler E., Song K.S., Sanders M.C., Lisanti M.P.Proc. Natl. Acad. Sci. U.S.A. 92:9407-9411(1995) Caveolin is palmitoylated on multiple cysteine residues. Palmitoylation is not necessary for localization of caveolin to caveolae.Dietzen D.J., Hastings W.R., Lublin D.M.J. Biol. Chem. 270:6838-6842(1995) Caveolin isoforms differ in their N-terminal protein sequence and subcellular distribution. Identification and epitope mapping of an isoform-specific monoclonal antibody probe.Scherer P.E., Tang Z., Chun M., Sargiacomo M., Lodish H.F., Lisanti M.P.J. Biol. Chem. 270:16395-16401(1995) Caveolin-1 expression inhibits Wnt/beta-catenin/Lef-1 signaling by recruiting beta-catenin to caveolae membrane domains.Galbiati F., Volonte D., Brown A.M., Weinstein D.E., Ben-Ze'ev A., Pestell R.G., Lisanti M.P.J. Biol. Chem. 275:23368-23377(2000)

NCBI and Uniprot Product Information

• NCBI GI #: 50979110
• NCBI GeneID: 403980
• NCBI Accession #: NP_001003296.1
• NCBI GenBank Nucleotide #: NM_001003296.1
• UniProt Accession #: P33724; A0M8U8
• Molecular Weight: 22.6 kDa
• NCBI Official Full Name: caveolin-1
• NCBI Official Symbol: CAV1
• NCBI Official Synonym Symbols: caveolin 1
• NCBI Protein Information: caveolin-1
• UniProt Protein Name: Caveolin-1
• UniProt Gene Name: CAV1
• UniProt Synonym Gene Names: CAV
• UniProt Entry Name: CAV1_CANLF