CD63 antigen Recombinant Protein | Cd63 recombinant protein

Recombinant Mouse CD63 antigen

Cat. Num. AAA113785

• Gene Names: Cd63; ME491; C75951; Tspan30
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: CD63 antigen; N/A; Recombinant Mouse CD63 antigen; CD63; Cd63 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 103-203. Partial
• Sequence: AGYVFRDQVKSEFNKSFQQQMQNYLKDNKTATILDKLQKENNCCGASNYTDWENIPGMAKDRVPDSCCINITVGCGNDFKESTIHTQGCVETIAIWLRKNI

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for Cd63 recombinant protein

Functions as cell surface receptor for TIMP1 and plays a role in the activation of cellular signaling cascades. Plays a role in the activation of ITGB1 and integrin signaling, leading to the activation of AKT, FAK/PTK2 and MAP kinases. Promotes cell survival, reorganization of the actin cytoskeleton, cell adhesion, spreading and migration, via its role in the activation of AKT and FAK/PTK2. Plays a role in VEGFA signaling via its role in regulating the internalization of KDR/VEGFR2. Plays a role in intracellular vesicular transport processes, and is required for normal trafficking of the PMEL luminal domain that is essential for the development and maturation of melanocytes. Plays a role in the adhesion of leukocytes onto endothelial cells via its role in the regulation of SELP trafficking. May play a role in mast cell degranulation in response to Ms4a2/FceRI stimulation, but not in mast cell degranulation in response to other stimuli.

References

Molecular cloning of the murine homologue of CD63/ME491 and detection of its strong expression in the kidney and activated macrophages.Miyamoto M., Homma M., Hotta H.Biochim. Biophys. Acta 1217:312-316(1994) Deficiency of the tetraspanin CD63 associated with kidney pathology but normal lysosomal function.Schroder J., Lullmann-Rauch R., Himmerkus N., Pleines I., Nieswandt B., Orinska Z., Koch-Nolte F., Schroder B., Bleich M., Saftig P.Mol. Cell. Biol. 29:1083-1094(2009) Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins.Wollscheid B., Bausch-Fluck D., Henderson C., O'Brien R., Bibel M., Schiess R., Aebersold R., Watts J.D.Nat. Biotechnol. 27:378-386(2009) CD63 is an essential cofactor to leukocyte recruitment by endothelial P-selectin.Doyle E.L., Ridger V., Ferraro F., Turmaine M., Saftig P., Cutler D.F.Blood 118:4265-4273(2011) The tetraspanin CD63 regulates ESCRT-independent and -dependent endosomal sorting during melanogenesis.van Niel G., Charrin S., Simoes S., Romao M., Rochin L., Saftig P., Marks M.S., Rubinstein E., Raposo G.Dev. Cell 21:708-721(2011) Tetraspanin CD63 promotes vascular endothelial growth factor receptor 2-beta1 integrin complex formation, thereby regulating activation and downstream signaling in endothelial cells in vitro and in vivo.Tugues S., Honjo S., Konig C., Padhan N., Kroon J., Gualandi L., Li X., Barkefors I., Thijssen V.L., Griffioen A.W., Claesson-Welsh L.J. Biol. Chem. 288:19060-19071(2013) The tetraspanin CD63 is required for efficient IgE-mediated mast cell degranulation and anaphylaxis.Kraft S., Jouvin M.H., Kulkarni N., Kissing S., Morgan E.S., Dvorak A.M., Schroder B., Saftig P., Kinet J.P.J. Immunol. 191:2871-2878(2013)

NCBI and Uniprot Product Information

• NCBI GI #: 110431344
• NCBI GeneID: 12512
• NCBI Accession #: NP_001036045.1
• NCBI GenBank Nucleotide #: NM_001042580.1
• UniProt Accession #: P41731
• Molecular Weight: 15.5
• NCBI Official Full Name: CD63 antigen
• NCBI Official Synonym Full Names: CD63 antigen
• NCBI Official Symbol: Cd63
• NCBI Official Synonym Symbols: ME491; C75951; Tspan30
• NCBI Protein Information: CD63 antigen
• UniProt Protein Name: CD63 antigen
• UniProt Gene Name: Cd63
• UniProt Entry Name: CD63_MOUSE