Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA113466_SDS_PAGE15.jpg SDS-PAGE

CD70 antigen (CD70) Recombinant Protein | CD70 recombinant protein

Recombinant Human CD70 antigen (CD70), partial

Gene Names
CD70; CD27L; CD27-L; CD27LG; TNFSF7; TNLG8A
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
CD70 antigen (CD70); N/A; Recombinant Human CD70 antigen (CD70), partial; CD70 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
39-193aa, Extracellular domain
Sequence
QRFAQAQQQLPLESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP
Sequence Length
193
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-PAGE

product-image-AAA113466_SDS_PAGE15.jpg SDS-PAGE
Related Product Information for CD70 recombinant protein
This protein is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for TNFRSF27
CD27. It is a surface antigen on activated, but not on resting, T and B lymphocytes. It induces proliferation of costimulated T cells, enhances the generation of cytolytic T cells, and contributes to T cell activation. This cytokine is also reported to play a role in regulating B-cell activation, cytotoxic function of natural killer cells, and immunoglobulin sythesis.
Product Categories/Family for CD70 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
970
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
19.1 kDa
NCBI Official Full Name
CD70 antigen isoform 1
NCBI Official Synonym Full Names
CD70 molecule
NCBI Official Symbol
CD70
NCBI Official Synonym Symbols
CD27L; CD27-L; CD27LG; TNFSF7; TNLG8A
NCBI Protein Information
CD70 antigen
UniProt Protein Name
CD70 antigen
UniProt Gene Name
CD70
UniProt Synonym Gene Names
CD27L; CD27LG; TNFSF7; CD27-L

Similar Products

Product Notes

The CD70 cd70 (Catalog #AAA113466) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 39-193aa, Extracellular domain. The amino acid sequence is listed below: QRFAQAQQQL PLESLGWDVA ELQLNHTGPQ QDPRLYWQGG PALGRSFLHG PELDKGQLRI HRDGIYMVHI QVTLAICSST TASRHHPTTL AVGICSPASR SISLLRLSFH QGCTIASQRL TPLARGDTLC TNLTGTLLPS RNTDETFFGV QWVRP. It is sometimes possible for the material contained within the vial of "CD70 antigen (CD70), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.