T-cell surface glycoprotein CD8 alpha chain Recombinant Protein | CD8A recombinant protein
Recombinant Bovine T-cell surface glycoprotein CD8 alpha chain
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
T-cell surface glycoprotein CD8 alpha chain; N/A; Recombinant Bovine T-cell surface glycoprotein CD8 alpha chain; CD8a; CD8A recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
26-189aa; Extracellular Domain
Sequence
LSFRMSPTQKETRLGEKVELQCELLQSGMATGCSWLRHIPGDDPRPTFLMYLSAQRVKLAEGLDPRHISGAKVSGTKFQLTLSSFLQEDQGYYFCSVVSNSILYFSNFVPVFLPAKPATTPAMRPSSAAPTSAPQTRSVSPRSEVCRTSAGSAVDTSRLDFACN
Sequence Length
242
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Related Product Information for CD8A recombinant protein
Identifies cytotoxic/suppressor T-cells that interact with MHC class I bearing targets. CD8 is thought to play a role in the process of T-cell mediated killing. CD8 alpha chains binds to class I MHC molecules alpha-3 domains.
References
Molecular cloning, reconstruction and expression of the gene encoding the alpha-chain of the bovine CD8 -- definition of three peptide regions conserved across species.Lalor P., Bucci C., Fornaro M., Rattazzi M.C., Nakauchi H., Herzenberg L.A., Alberti S.Immunology 76:95-102(1992)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
19.9 kDa
NCBI Official Full Name
T-cell surface glycoprotein CD8 alpha chain
NCBI Official Symbol
CD8A
NCBI Protein Information
T-cell surface glycoprotein CD8 alpha chain
UniProt Protein Name
T-cell surface glycoprotein CD8 alpha chain
UniProt Gene Name
CD8A
UniProt Entry Name
CD8A_BOVIN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The CD8A cd8a (Catalog #AAA113517) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 26-189aa; Extracellular Domain. The amino acid sequence is listed below: LSFRMSPTQK ETRLGEKVEL QCELLQSGMA TGCSWLRHIP GDDPRPTFLM YLSAQRVKLA EGLDPRHISG AKVSGTKFQL TLSSFLQEDQ GYYFCSVVSN SILYFSNFVP VFLPAKPATT PAMRPSSAAP TSAPQTRSVS PRSEVCRTSA GSAVDTSRLD FACN. It is sometimes possible for the material contained within the vial of "T-cell surface glycoprotein CD8 alpha chain, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
