Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA18530_SDS_PAGE.png SDS-PAGE

T-cell surface glycoprotein CD8 alpha chain (CD8A) Recombinant Protein | CD8A recombinant protein

Recombinant Human T-cell surface glycoprotein CD8 alpha chain (CD8A), partial

Gene Names
CD8A; CD8; MAL; p32; Leu2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
T-cell surface glycoprotein CD8 alpha chain (CD8A); N/A; Recombinant Human T-cell surface glycoprotein CD8 alpha chain (CD8A), partial; T-lymphocyte differentiation antigen T8/Leu-2; CD_antigen: CD8a; CD8A recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
22-182aa; Partial (Extracellular domain)
Sequence
SQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

product-image-AAA18530_SDS_PAGE.png SDS-PAGE
Related Product Information for CD8A recombinant protein
Identifies cytotoxic/suppressor T-cells that interact with MHC class I bearing targets. CD8 is thought to play a role in the process of T-cell mediated killing. CD8 alpha chains binds to class I MHC molecules alpha-3 domains.
Product Categories/Family for CD8A recombinant protein
References
"The isolation and sequence of the gene encoding T8: a molecule defining functional classes of T lymphocytes." Littman D.R., Thomas Y., Maddon P.J., Chess L., Axel R. Cell 40:237-246(1985)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
925
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
19.6 kDa
NCBI Official Full Name
T-cell surface glycoprotein CD8 alpha chain isoform 1
NCBI Official Synonym Full Names
CD8a molecule
NCBI Official Symbol
CD8A
NCBI Official Synonym Symbols
CD8; MAL; p32; Leu2
NCBI Protein Information
T-cell surface glycoprotein CD8 alpha chain
UniProt Protein Name
T-cell surface glycoprotein CD8 alpha chain
UniProt Gene Name
CD8A
UniProt Synonym Gene Names
MAL
UniProt Entry Name
CD8A_HUMAN

Similar Products

Product Notes

The CD8A cd8a (Catalog #AAA18530) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 22-182aa; Partial (Extracellular domain). The amino acid sequence is listed below: SQFRVSPLDR TWNLGETVEL KCQVLLSNPT SGCSWLFQPR GAAASPTFLL YLSQNKPKAA EGLDTQRFSG KRLGDTFVLT LSDFRRENEG YYFCSALSNS IMYFSHFVPV FLPAKPTTTP APRPPTPAPT IASQPLSLRP EACRPAAGGA VHTRGLDFAC D. It is sometimes possible for the material contained within the vial of "T-cell surface glycoprotein CD8 alpha chain (CD8A), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.