Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Have a question or looking for a specific datasheet Manual/COA/MSDS?
Submit a Question

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Chymotrypsin-like elastase family member 2A (Cela2a) Recombinant Protein | Cela2a recombinant protein

Recombinant Mouse Chymotrypsin-like elastase family member 2A (Cela2a)

Gene Names
Cela2a; Ela2; Ela-2; Ela2a
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Chymotrypsin-like elastase family member 2A (Cela2a); Recombinant Mouse Chymotrypsin-like elastase family member 2A (Cela2a); Elastase-2; Elastase-2A; Cela2a recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
31-271aa; Full Length of Mature Protein
Sequence
VVGGQEATPNTWPWQVSLQVLSSGRWRHNCGGSLVANNWVLTAAHCLSNYQTYRVLLGAHSLSNPGAGSAAVQVSKLVVHQRWNSQNVGNGYDIALIKLASPVTLSKNIQTACLPPAGTILPRNYVCYVTGWGLLQTNGNSPDTLRQGRLLVVDYATCSSASWWGSSVKSSMVCAGGDGVTSSCNGDSGGPLNCRASNGQWQVHGIVSFGSSLGCNYPRKPSVFTRVSNYIDWINSVMARN
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

SDS-PAGE
References
Sequence organisation and transcriptional regulation of the mouse elastase II and trypsin genes.Stevenson B.J., Hagenbuechle O., Wellauer P.K.Nucleic Acids Res. 14:8307-8330(1986)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27.7 kDa
NCBI Official Full Name
chymotrypsin-like elastase family member 2A
NCBI Official Synonym Full Names
chymotrypsin-like elastase family, member 2A
NCBI Official Symbol
Cela2a
NCBI Official Synonym Symbols
Ela2; Ela-2; Ela2a
NCBI Protein Information
chymotrypsin-like elastase family member 2A
UniProt Protein Name
Chymotrypsin-like elastase family member 2A
UniProt Gene Name
Cela2a
UniProt Synonym Gene Names
Ela-2; Ela2; Ela2a
UniProt Entry Name
CEL2A_MOUSE

Similar Products

Product Notes

The Cela2a cela2a (Catalog #AAA18698) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 31-271aa; Full Length of Mature Protein. The amino acid sequence is listed below: VVGGQEATPN TWPWQVSLQV LSSGRWRHNC GGSLVANNWV LTAAHCLSNY QTYRVLLGAH SLSNPGAGSA AVQVSKLVVH QRWNSQNVGN GYDIALIKLA SPVTLSKNIQ TACLPPAGTI LPRNYVCYVT GWGLLQTNGN SPDTLRQGRL LVVDYATCSS ASWWGSSVKS SMVCAGGDGV TSSCNGDSGG PLNCRASNGQ WQVHGIVSFG SSLGCNYPRK PSVFTRVSNY IDWINSVMAR N . It is sometimes possible for the material contained within the vial of "Chymotrypsin-like elastase family member 2A (Cela2a), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.