Application Data
(Fig-1: Detection of mouse B7-H4 in the CHO-K1/mB7-H4 stable cell line by Flow Cytometry. CHO-K1 cells (Green); CHO-K1/mB7-H4 cells (Red).)
B7-H4 cell line
mB7-H4 Stable Cell Line
Gene Names
VTCN1; B7X; B7H4; B7S1; B7-H4; B7h.5; VCTN1; PRO1291
Applications
Western Blot, Immunocytochemistry, Flow Cytometry, Functional Assay
Synonyms
B7-H4; N/A; mB7-H4 Stable Cell Line; B7-H4 cell line
Form/Format
Each vial contains 2 ~ 3 x 10^6 cells in 1 ml of 90% FBS + 10% DMSO.
Sequence
mB7-H4 (accession number NM_178594)
MASLGQIIFWSIINIIIILAGAIALIIGFGISGKHFITVTTFTSAGNIGEDGTLSCTFEPDIKLNGIVIQWLKEGIKGLVHEFKEGKDDLSQQHEMFRGRTAVFADQVVVGNASLRLKNVQLTDAGTYTCYIRTSKGKGNANLEYKTGAFSMPEINVDYNASSESLRCEAPRWFPQPTVAWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTDSEVKRRSQLQLLNSGPSPCVFSSAFVAGWALLSLSCCLMLR
MASLGQIIFWSIINIIIILAGAIALIIGFGISGKHFITVTTFTSAGNIGEDGTLSCTFEPDIKLNGIVIQWLKEGIKGLVHEFKEGKDDLSQQHEMFRGRTAVFADQVVVGNASLRLKNVQLTDAGTYTCYIRTSKGKGNANLEYKTGAFSMPEINVDYNASSESLRCEAPRWFPQPTVAWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTDSEVKRRSQLQLLNSGPSPCVFSSAFVAGWALLSLSCCLMLR
Applicable Applications for B7-H4 cell line
WB (Western Blot), ICC (Immunocytochemistry), FCM/FACS (Flow Cytometry)
Dry Ice Shipment
Extra charge fee may add to your shipping cost as dry ice is required to ship this product.
Preparation and Storage
Immediately upon receipt, store in liquid nitrogen.
Dry Ice Shipment: Extra charge fee may add to your shipping cost as dry ice is required to ship this product.
Shipping Note: Product is available for shipment in the United States, Canada and European countries. Please inquire for shipment to other countries.
Dry Ice Shipment: Extra charge fee may add to your shipping cost as dry ice is required to ship this product.
Shipping Note: Product is available for shipment in the United States, Canada and European countries. Please inquire for shipment to other countries.
Application Data
(Fig-1: Detection of mouse B7-H4 in the CHO-K1/mB7-H4 stable cell line by Flow Cytometry. CHO-K1 cells (Green); CHO-K1/mB7-H4 cells (Red).)
Application Data
(Fig-1: Detection of mouse B7-H4 in the CHO-K1/mB7-H4 stable cell line by Flow Cytometry. CHO-K1 cells (Green); CHO-K1/mB7-H4 cells (Red).)
Related Product Information for B7-H4 cell line
mB7-H4 Stable Cell Line is a stably transfected CHO-K1 cell line which expresses mouse B7-H4, also known as VTCN1.
Product Categories/Family for B7-H4 cell line
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Official Full Name
B7-H4
NCBI Official Synonym Full Names
V-set domain containing T-cell activation inhibitor 1
NCBI Official Symbol
VTCN1
NCBI Official Synonym Symbols
B7X; B7H4; B7S1; B7-H4; B7h.5; VCTN1; PRO1291
NCBI Protein Information
V-set domain-containing T-cell activation inhibitor 1
UniProt Protein Name
V-set domain-containing T-cell activation inhibitor 1
UniProt Gene Name
VTCN1
UniProt Synonym Gene Names
B7-H4
Similar Products
Product Notes
The B7-H4 vtcn1 (Catalog #AAA78375) is a Cell Line and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's B7-H4 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), ICC (Immunocytochemistry), FCM/FACS (Flow Cytometry). Researchers should empirically determine the suitability of the B7-H4 vtcn1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: mB7-H4 (accession number NM_178594) MASLGQ IIFWSIINII IILAGAIALI IGFGISGKHF ITVTTFTSAG NIGEDGTLSC TFEPDIKLNG IVIQWLKEGI KGLVHEFKEG KDDLSQQHEM FRGRTAVFAD QVVVGNASLR LKNVQLTDAG TYTCYIRTSK GKGNANLEYK TGAFSMPEIN VDYNASSESL RCEAPRWFPQ PTVAWASQVD QGANFSEVSN TSFELNSENV TMKVVSVLYN VTINNTYSCM IENDIAKATG DIKVTDSEVK RRSQLQLLNS GPSPCVFSSA FVAGWALLSL SCCLMLR. It is sometimes possible for the material contained within the vial of "B7-H4, Cell Line" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.