Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA78372_AD15.png Application Data (Fig-1: Detection of human CTLA4 in the CHO-K1/CTLA4 stable cell line by Flow Cytometry. CHO-K1 cells (Green); CHO-K1/CTLA4 cells (Red).)

CTLA4 cell line

CTLA4 Stable Cell Line

Average rating 0.0
No ratings yet
Gene Names
CTLA4; CD; GSE; GRD4; ALPS5; CD152; CTLA-4; IDDM12; CELIAC3
Applications
Functional Assay
Synonyms
CTLA4; N/A; CTLA4 Stable Cell Line; CTLA4 cell line
Ordering
Form/Format
Each vial contains 2~3 x 106 cells in 1 ml of 90% FBS + 10% DMSO.
Sequence
MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Applicable Applications for CTLA4 cell line
FA (Functional Assay)
Sequence Data
hCTLA4 (accession number NM_005214)
Culture Conditions
Cells should be grown at 37°C with 5% CO2 using DMEM medium (w/ L-Glutamine, 4.5g/L Glucose and Sodium Pyruvate) supplemented with 10% heat-inactivated FBS supplemented with 10% FBS and 1% Pen/Strep, plus 10 ug/ml of Blasticidin.

It is recommended to quickly thaw the frozen cells upon receipt or from liquid nitrogen in a 37°C water-bath, transfer to a tube containing 10 ml of growth medium without Blasticidin, spin down cells, resuspend cells in pre-warmed growth medium without Blasticidin, transfer resuspended cells to T25 flask and culture in 37°C-CO2 incubator.

Leave the T25 flask in the incubator for 1~2 days without disturbing or changing the medium until cells completely recover viability and become adherent. Once cells are over 90% adherent, remove growth medium and passage the cells through trypsinization and centrifugation. At first passage, switch to growth medium containing Blasticidin. Cells should be split before they reach complete confluence.

To passage the cells, detach cells from culture vessel with Trypsin/EDTA, add complete growth medium and transfer to a tube, spin down cells, resuspend cells and seed appropriate aliquots of cells suspension into new culture vessels. Subcultivation ration = 1:10 to 1:20 weekly. To achieve satisfactory results, cells should not be passaged over 16 times.
Dry Ice Note
The product may be shipped with dry ice, and an additional fee may be added to your shipping cost.
Preparation and Storage
Immediately upon receipt, store in liquid nitrogen.

Dry Ice Shipment: Extra charge fee may add to your shipping cost as dry ice is required to ship this product.

Shipping Note: Product is available for shipment in the United States, Canada and European countries. Please inquire for shipment to other countries.

Application Data

(Fig-1: Detection of human CTLA4 in the CHO-K1/CTLA4 stable cell line by Flow Cytometry. CHO-K1 cells (Green); CHO-K1/CTLA4 cells (Red).)

product-image-AAA78372_AD15.png Application Data (Fig-1: Detection of human CTLA4 in the CHO-K1/CTLA4 stable cell line by Flow Cytometry. CHO-K1 cells (Green); CHO-K1/CTLA4 cells (Red).)
Related Product Information for CTLA4 cell line
CTLA4 Stable Cell Line is a stably transfected CHO-K1 cell line which expresses human Cytotoxic T-Lymphocyte-Associated Protein 4 (CTLA4, also known as CD152).
Product Categories/Family for CTLA4 cell line

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
NCBI Official Full Name
cytotoxic T-lymphocyte protein 4 isoform CTLA4-TM
NCBI Official Synonym Full Names
cytotoxic T-lymphocyte associated protein 4
NCBI Official Symbol
CTLA4
NCBI Official Synonym Symbols
CD; GSE; GRD4; ALPS5; CD152; CTLA-4; IDDM12; CELIAC3
NCBI Protein Information
cytotoxic T-lymphocyte protein 4
UniProt Protein Name
Cytotoxic T-lymphocyte protein 4
UniProt Gene Name
CTLA4
UniProt Synonym Gene Names
CD152; CTLA-4

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The CTLA4 ctla4 (Catalog #AAA78372) is a Cell Line and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's CTLA4 can be used in a range of immunoassay formats including, but not limited to, FA (Functional Assay). Researchers should empirically determine the suitability of the CTLA4 ctla4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MACLGFQRHK AQLNLATRTW PCTLLFFLLF IPVFCKAMHV AQPAVVLASS RGIASFVCEY ASPGKATEVR VTVLRQADSQ VTEVCAATYM MGNELTFLDD SICTGTSSGN QVNLTIQGLR AMDTGLYICK VELMYPPPYY LGIGNGTQIY VIDPEPCPDS DFLLWILAAV SSGLFFYSFL LTAVSLSKML KKRSPLTTGV YVKMPPTEPE CEKQFQPYFI PIN. It is sometimes possible for the material contained within the vial of "CTLA4, Cell Line" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request Manual

Please complete the form below and a representative will contact you as soon as possible.

Request Quote

Please complete the form below and a representative will contact you as soon as possible.