FCM/FACS (Flow Cytometry)
(Fig-2: Detection of GFP in the GFP/Jurkat stable cell line through flow cytometry. Parental Jurkat cells (Green); GFP/Jurkat cells (Red).)
GFP/Jurkat Stable Cell Line | GFP cell line
GFP/Jurkat Stable Cell Line
Applications
Flow Cytometry, Functional Assay, Functional Assay
Synonyms
GFP/Jurkat Stable; N/A; GFP/Jurkat Stable Cell Line; GFP cell line
Form/Format
Each vial contains 2 ~ 3 x 10^6 cells in 1 ml of 90% FBS + 10% DMSO
Sequence
Amino acid sequence of eGFP: MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK
Applicable Applications for GFP cell line
FCM/FACS (Flow Cytometry), FA (Functional Assay)
Culture conditions
Cells should be grown at 37 degree C with 5% CO2 using RPMI medium supplemented with 10% heat-inactivated FBS, 1 mM sodium pyruvate, 10 mM HEPES and 1% Pen/Strep, plus 3 ug/ml of Puromycin. It is recommended to quickly thaw the frozen cells upon receipt or from liquid nitrogen in a 37 degree C water-bath, transfer to a tube containing 10 ml of growth medium without Puromycin, spin down cells, resuspend cells in pre-warmed growth medium without Puromycin, transfer resuspended cells to T25 flask and culture in 37 degree C-CO2 incubator. Monitor the cell viability by counting cells daily for 1-3 days until cells completely recover viability as cells are doubling daily. Once cells are over 90% confluent, harvest cells by centrifugation and passage cells. At first, switch to growth medium containing puromycin. Cells should be split before they reach complete confluence. To passage the cells, transfer cells to a tube, spin down cells, resuspend cells and seed appropriate aliquots of cells suspension into new culture vessels. Subcultivation ration = 1:10 to 1:20 weekly. To achieve satisfactory results, cells should not be passaged over 16 times.
Preparation and Storage
Upon receipt, store at -20 degree C (Stable for at least 6 months). Avoid frequent freeze/thaw cycles.
FCM/FACS (Flow Cytometry)
(Fig-2: Detection of GFP in the GFP/Jurkat stable cell line through flow cytometry. Parental Jurkat cells (Green); GFP/Jurkat cells (Red).)
FCM/FACS (Flow Cytometry)
(Fig-2: Detection of GFP in the GFP/Jurkat stable cell line through flow cytometry. Parental Jurkat cells (Green); GFP/Jurkat cells (Red).)
Application Data
(Fig-1: Analysis of the GFP/Jurkat stable cell line through fluorescence microscopy. Bright-field image (Left); Fluorescence image (Right).)
Application Data
(Fig-1: Analysis of the GFP/Jurkat stable cell line through fluorescence microscopy. Bright-field image (Left); Fluorescence image (Right).)
Related Product Information for GFP cell line
GFP/Jurkat Stable Cell Line is a stably transfected Jurkat cell line which expresses enhanced green fluorescent protein (eGFP).
Product Categories/Family for GFP cell line
Similar Products
Product Notes
The GFP (Catalog #AAA78591) is a Cell Line and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's GFP/Jurkat Stable can be used in a range of immunoassay formats including, but not limited to, FCM/FACS (Flow Cytometry), FA (Functional Assay). Researchers should empirically determine the suitability of the GFP for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Amino acid sequence of eGFP: MVSKGEELFT GVVPILVELD GDVNGHKFSV SGEGEGDATY GKLTLKFICT TGKLPVPWPT LVTTLTYGVQ CFSRYPDHMK QHDFFKSAMP EGYVQERTIF FKDDGNYKTR AEVKFEGDTL VNRIELKGID FKEDGNILGH KLEYNYNSHN VYIMADKQKN GIKVNFKIRH NIEDGSVQLA DHYQQNTPIG DGPVLLPDNH YLSTQSALSK DPNEKRDHMV LLEFVTAAGI TLGMDELYK. It is sometimes possible for the material contained within the vial of "GFP/Jurkat Stable, Cell Line" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.