Carboxylesterase 1C Recombinant Protein | EST1C recombinant protein
Recombinant mouse Carboxylesterase 1C
Gene Names
Ces1c; Ee1; Es1; Es4; EsN; Ee-1; Es-4; Es-N; PESN; Ces-N
Reactivity
Mouse
Purity
Greater than 90% as determined by SDS-PAGE.
Synonyms
Carboxylesterase 1C; N/A; Recombinant mouse Carboxylesterase 1C; Liver carboxylesterase NLung surfactant convertasePES-N; EST1C recombinant protein
Host
E Coli
Reactivity
Mouse
Purity/Purification
Greater than 90% as determined by SDS-PAGE.
Form/Format
Tris-based buffer50% glycero
Sequence Positions
Partial
Sequence
HSLLPPVVDTTQGKVLGKYISLEGFEQPVAVFLGVPFAKPPLGSLRFAPPQPAEPWSFVKNATSYPPMCSQDA
GWAKILSDMFSTEKEILPLKISEDCLYLNIYSPADLTKSSQLPVMVWIHGGGLVIGGASPYNGLALSAHENVVVV
TIQYRLGIWGLFSTGDEHSPGNWAHLDQLAALRWVQDNIANFGGNPDSVTIFGESSGGISVSVLVLSPLGKDL
FHRAISESGVVINTNVGKKNIQAVNEIIATLSQCNDTSSAAMVQCLRQKTESELLEISGKLVQYNISLSTMIDGVV
LPKAPEEILAEKSFNTVPYIVGFNKQEFGWIIPMMLQNLLPEGKMNEETASLLLRRFHSELNISESMIPAVIEQYL
RGVDDPAKKSELILDMFGDIFFGIPAVLLSRSLRDAGVSTYMYEFRYRPSFVSDKRPQTVEGDHGDEIFFVFGA
PLLKEGASEEETNLSKMVMKFWANFARNGNPNGEGLPHWPEYDEQEGYLQIGATTQQAQRLKAEEVAFWTE
LLAKNPPETDPTEH
Expression Region
19-550
Tag Info
N-terminal GST-tagged
Preparation and Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability
of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C,-80°C. The shelf life of lyophilized form is 12 months at -20°C,-80°C.Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Generally, the shelf life of liquid form is 6 months at -20°C,-80°C. The shelf life of lyophilized form is 12 months at -20°C,-80°C.Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Related Product Information for EST1C recombinant protein
Involved in the detoxification of xenobiotics and in the activation of ester and amide prodrugs. Involved in the Extracellular domain metabolism of lung surfactant.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
85.6 kD
NCBI Official Full Name
carboxylesterase 1C
NCBI Official Synonym Full Names
carboxylesterase 1C
NCBI Official Symbol
Ces1c
NCBI Official Synonym Symbols
Ee1; Es1; Es4; EsN; Ee-1; Es-4; Es-N; PESN; Ces-N
NCBI Protein Information
carboxylesterase 1C
UniProt Protein Name
Carboxylesterase 1C
UniProt Gene Name
Ces1c
UniProt Synonym Gene Names
Es1
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The EST1C ces1c (Catalog #AAA309752) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is Partial. The Recombinant mouse Carboxylesterase 1C reacts with Mouse and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: HSLLPPVVDT TQGKVLGKYI SLEGFEQPVA VFLGVPFAKP PLGSLRFAPP QPAEPWSFVK NATSYPPMCS QDA GWAKIL SDMFSTEKEI LPLKISEDCL YLNIYSPADL TKSSQLPVMV WIHGGGLVIG GASPYNGLAL SAHENVVVV TIQYRLGIWG LFSTGDEHSP GNWAHLDQLA ALRWVQDNIA NFGGNPDSVT IFGESSGGIS VSVLVLSPLG KDL FHRAIS ESGVVINTNV GKKNIQAVNE IIATLSQCND TSSAAMVQCL RQKTESELLE ISGKLVQYNI SLSTMIDGVV LPKAPEEIL AEKSFNTVPY IVGFNKQEFG WIIPMMLQNL LPEGKMNEET ASLLLRRFHS ELNISESMIP AVIEQYL RG VDDPAKKSEL ILDMFGDIFF GIPAVLLSRS LRDAGVSTYM YEFRYRPSFV SDKRPQTVEG DHGDEIFFVF GA PLLKEGA SEEETNLSKM VMKFWANFAR NGNPNGEGLP HWPEYDEQEG YLQIGATTQQ AQRLKAEEVA FWTE LLAKN PPETDPTEH. It is sometimes possible for the material contained within the vial of "Carboxylesterase 1C, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.