CD274 protein
CD274 (B7-H1)-muIg-Biotin
Gene Names
CD274; B7-H; B7H1; PDL1; PD-L1; PDCD1L1; PDCD1LG1
Reactivity
Human
Applications
ELISA
Synonyms
CD274; N/A; CD274 (B7-H1)-muIg-Biotin; Human CD274(B7-H1)-muIg/Biotin Fusion Protein; CD274 protein
Host
CHO cells
Reactivity
Human
Form/Format
50 mM Sodium Phosphate pH 7.5, 100 mM Potassium Chloride, 150mM NaCl, 5% Glycerol, 0.2% BSA.
Concentration
0.5 mg/ml (varies by lot)
Sequence
MuCD8 alpha signal peptide residual amino acids + linker:(1) kpqapelrgsas
CD274 mature EC: (224aa): (13)ftvtvpkdlyvveygsnmtieckfpvekqldlaalivywemedkniiqfvhgeedlkvqhssyrqrarllkdqlslgnaalqitdvklqdagvyrcmisyggadykritvkvnapynkinqrilvvdvtseheltcqaegypkaeviwtssdhqvlsgkttttnskreeklfnvtstlrintttneifyctfrrldpeenhtaelvipelplahppnerthtr
Linker + Murine IgG2a Hinge + Fc (235aa):
(237)gteprgptikpcppckcpapnllggpsvfifppkikdvlmislspivtcvvvdvseddpdvqiswfvnnvevhtaqtqthredynstlrvvsalpiqhqdwmsgkefkckvnnkdlpapiertiskpgsvrapqvyvlpppeeemtkkqvtltcmvtdfmpediyvewtnngktelnykntepvldsdgsyfmysklrvekknwvernsyscsvvheglhnhhttksfsrtpg(471)
CD274 mature EC: (224aa): (13)ftvtvpkdlyvveygsnmtieckfpvekqldlaalivywemedkniiqfvhgeedlkvqhssyrqrarllkdqlslgnaalqitdvklqdagvyrcmisyggadykritvkvnapynkinqrilvvdvtseheltcqaegypkaeviwtssdhqvlsgkttttnskreeklfnvtstlrintttneifyctfrrldpeenhtaelvipelplahppnerthtr
Linker + Murine IgG2a Hinge + Fc (235aa):
(237)gteprgptikpcppckcpapnllggpsvfifppkikdvlmislspivtcvvvdvseddpdvqiswfvnnvevhtaqtqthredynstlrvvsalpiqhqdwmsgkefkckvnnkdlpapiertiskpgsvrapqvyvlpppeeemtkkqvtltcmvtdfmpediyvewtnngktelnykntepvldsdgsyfmysklrvekknwvernsyscsvvheglhnhhttksfsrtpg(471)
Sequence Length
127
Applicable Applications for CD274 protein
ELISA
Molecular Structure
A soluble fusion protein consisting of the murine CD8 alpha leader sequence, the mature extracellular (224aa) domain of human CD274 fused to murine IgG2a Fc + hinge (233aa).
Transfectant Cell Line
CHO
Performance
Purity of recombinant protein was >90% by SDS-PAGE. N-terminal sequence was as predicted: KPQAP. Biotinylated recombinant protein was active in EIA, binding to anti-CD274 mAbs ANC6H1, clone M1H1, and recombinant CD279(PD1), using SA/HRP for detection.
Predicted monomeric (non glycosylated) molecular weight: 54.4kd. The molecule is dimeric and runs at about 120 kd in SDS-PAGE under native conditions.
Predicted monomeric (non glycosylated) molecular weight: 54.4kd. The molecule is dimeric and runs at about 120 kd in SDS-PAGE under native conditions.
Conjugation
Biotin
Production
Human CD274-muIg fusion protein was Protein A purified from (low FBS containing) tissue culture supernatant of CHO transfectants, and reacted with NHS-Biotin. Unconjugated Biotin was removed from conjugate by desalting column.
Buffer
50 mM Sodium Phosphate pH 7.5, 100 mM Potassium Chloride, 150mM NaCl, 5% Glycerol, 0.2% BSA, 0.04% NaN3 (as a preservative).
Molecular Weight
Predicted monomeric (non glycosylated) molecular weight: 54.4kd.
The molecule is dimeric and runs at about 120 kd in SDS-PAGE under native conditions.
The molecule is dimeric and runs at about 120 kd in SDS-PAGE under native conditions.
Buffer
50mM Sodium Phosphate pH7.5, 100mM Potassium Chloride, 150mM NaCl, 5% Glycerol, 0.2% BSA, 0.04% NaN3 (as a preservative).
Preparation and Storage
Store at 2 - 5 degree C. Freeze/Thawing is not recommended
Product should retain activity for at least 6 months after shipping date when stored as recommended.
Product should retain activity for at least 6 months after shipping date when stored as recommended.
Related Product Information for CD274 protein
Information: CD274 (B7-H1, PD-L1, Programmed Death Ligand) is a member of the B7 family and is expressed on a variety of tissues including lymphoid cells. It plays an important role in regulation of T cell activation, and is involved in progression of cancer, arthritis and HIV infection (3). CD274 binding to its receptor CD279 (PD-1) on activated T cells can decrease proliferation. Conversely, ligation of CD279 on primed T cells can stimulate IL-10 production. High levels of CD274 present in Renal cell carcinoma are associated with poor prognosis (1). Tumor expressed CD274 can increase apoptosis of tumor specific T cells resulting in better tumor cell survival (2). Gamma Interferon and PHA can up regulate CD274 expression on T cells.
References
1)Cancer Research (April 2006) 66:3381. 2)J Molecular Medicine (Feb 2004) 81(5):281. 3)Int J Hematol (Nov 2003) 78(4):321.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Official Full Name
CD274, partial
NCBI Official Synonym Full Names
CD274 molecule
NCBI Official Symbol
CD274
NCBI Official Synonym Symbols
B7-H; B7H1; PDL1; PD-L1; PDCD1L1; PDCD1LG1
NCBI Protein Information
programmed cell death 1 ligand 1; B7 homolog 1; CD274 antigen; PDCD1 ligand 1; programmed death ligand 1
UniProt Protein Name
Programmed cell death 1 ligand 1
UniProt Gene Name
CD274
UniProt Synonym Gene Names
B7H1; PDCD1L1; PDCD1LG1; PDL1; PD-L1; PDCD1 ligand 1; Programmed death ligand 1; B7-H1
UniProt Entry Name
PD1L1_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The CD274 cd274 (Catalog #AAA78192) is a Protein produced from CHO cells and is intended for research purposes only. The product is available for immediate purchase. The CD274 (B7-H1)-muIg-Biotin reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CD274 can be used in a range of immunoassay formats including, but not limited to, ELISA. Researchers should empirically determine the suitability of the CD274 cd274 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MuCD8 alpha signal peptide residual amino acids + linker:(1) kpqapelrgs as CD274 mature EC: (224aa): ( 13)ftvtvpk dlyvveygsn mtieckfpve kqldlaaliv ywemedknii qfvhgeedlk vqhssyrqra rllkdqlslg naalqitdvk lqdagvyrcm isyggadykr itvkvnapyn kinqrilvvd vtseheltcq aegypkaevi wtssdhqvls gkttttnskr eeklfnvtst lrintttnei fyctfrrldp eenhtaelvi pelplahppn erthtr Linker + Murine IgG2a Hinge + Fc (235aa):(237)gte prgptikpcp pckcpapnll ggpsvfifpp kikdvlmisl spivtcvvvd vseddpdvqi swfvnnvevh taqtqthred ynstlrvvsa lpiqhqdwms gkefkckvnn kdlpapiert iskpgsvrap qvyvlpppee emtkkqvtlt cmvtdfmped iyvewtnngk telnykntep vldsdgsyfm ysklrvekkn wvernsyscs vvheglhnhh ttksfsrtpg (471). It is sometimes possible for the material contained within the vial of "CD274, Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.