Chorionic Gonadotropin Beta Recombinant Protein | beta-HCG recombinant protein
Recombinant Human Chorionic Gonadotropin Beta (beta-HCG)
Applications
ELISA, Western Blot
Purity
> 90 % as determined by SDS-PAGE.
Synonyms
Chorionic Gonadotropin Beta; N/A; Recombinant Human Chorionic Gonadotropin Beta (beta-HCG); CG-B; CGB3; hCGB; HCG; CGb; CGb5; CGb7; CGb8; Choriogonadotropin subunit beta; beta-HCG recombinant protein
Host
E. coli AA 1-165 (P0DN86).
Purity/Purification
> 90 % as determined by SDS-PAGE.
Form/Format
Powder
58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, pH 7.4 added with 5 % trehalose and 5 % mannitol are added as protectants before lyophilization
58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, pH 7.4 added with 5 % trehalose and 5 % mannitol are added as protectants before lyophilization
Concentration
1 mg/mL (varies by lot)
Sequence
MEMFQGLLLLLLLSMGGTWASKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALS CQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSSSKAPPPSLPSPSRLPGPSDTPILPQ
Applicable Applications for beta-HCG recombinant protein
ELISA, WB (Western Blot)
Source
Human
Protein Residue
with His-tag.
Protein Residues
with N-terminal 6-His.
Predicted MW
22 kDa
Observed MW
22 kDa
Usage
beta-HCG Protein-Centrifuge the standard vialat6000-10000 rpm for 30s.Reconstitute at 0.25mg/mL in 200 uL sterile water for short-term storage.
Reconstitution with 200 uL 50% glycerol solution is recommended for long term storage. Swirl or mix gently to insure complete and homogeneous solubilization.
Reconstitution with 200 uL 50% glycerol solution is recommended for long term storage. Swirl or mix gently to insure complete and homogeneous solubilization.
Preparation and Storage
Store it under sterile conditions at -20°C upon receiving. Recommend to aliquot the protein into smaller quantities for optimal storage.**Avoid repeated freeze-thaw cycles.**
The recombinant protein is stable for up to 6 months from date of receipt at -80°C.
The recombinant protein is stable for up to 6 months from date of receipt at -80°C.
Related Product Information for beta-HCG recombinant protein
By restriction digest analysis, Talmadge et al. (1983) determined that the 7 CGB genes are extremely similar but not identical. Otani et al. (1988) found that CGB3 and CBG8 were expressed at 2-fold lower levels than CGB5 following transfection into a mouse adrenocortical cell line. Bo and Boime (1992) determined that most of the sequence variation among the CGB genes occurs in the nontranslated region of exon 1. They further found that CGB3 was expressedat about the same levels at CGB8 in first trimester placenta and in a choriocarcinoma cell line, and both were expressed at a lower level than CGB5. Jameson and Lindell (1988) determined that each of the CGB genes contains 3 exons. Otani et al. (1988) determined that the promoter regions contain no CAAT. or TATAA boxes.
Similar Products
Product Notes
The beta-HCG (Catalog #AAA55766) is a Recombinant Protein produced from E. coli AA 1-165 (P0DN86). and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Chorionic Gonadotropin Beta can be used in a range of immunoassay formats including, but not limited to, ELISA, WB (Western Blot). Researchers should empirically determine the suitability of the beta-HCG for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MEMFQGLLLL LLLSMGGTWA SKEPLRPRCR PINATLAVEK EGCPVCITVN TTICAGYCPT MTRVLQGVLP ALPQVVCNYR DVRFESIRLP GCPRGVNPVV SYAVALS CQCALCRRST TDCGGPKDHP LTCDDPRFQD SSSSKAPPPS LPSPSRLPGP SDTPILPQ. It is sometimes possible for the material contained within the vial of "Chorionic Gonadotropin Beta, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
