Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us

CB1 cannabinoid receptor-interacting protein 1 (CNRIP1) Recombinant Protein | CNRIP1 recombinant protein

Recombinant Human CB1 cannabinoid receptor-interacting protein 1 (CNRIP1)

Average rating 0.0
No ratings yet
Gene Names
CNRIP1; CRIP1; C2orf32
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
CB1 cannabinoid receptor-interacting protein 1 (CNRIP1); N/A; Recombinant Human CB1 cannabinoid receptor-interacting protein 1 (CNRIP1); CNRIP1 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-164, Full length protein
Sequence
MGDLPGLVRLSIALRIQPNDGPVFYKVDGQRFGQNRTIKLLTGSSYKVEVKIKPSTLQVENISIGGVLVPLELKSKEPDGDRVVYTGTYDTEGVTPTKSGERQPIQITMPFTDIGTFETVWQVKFYNYHKRDHCQWGSPFSVIEYECKPNETRSLMWVNKESFL
Sequence Length
164
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for CNRIP1 recombinant protein
This gene encodes a G-protein coupled receptor which interacts with the C-terminal tail of cannabinoid receptor 1. This receptor plays a role in synaptic plasticity, analgesia, appetite, and neuroprotection. Two transcript variants encoding different isoforms have been described for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
14,224 Da
NCBI Official Full Name
CB1 cannabinoid receptor-interacting protein 1 isoform CRIP1b
NCBI Official Synonym Full Names
cannabinoid receptor interacting protein 1
NCBI Official Symbol
CNRIP1
NCBI Official Synonym Symbols
CRIP1; C2orf32
NCBI Protein Information
CB1 cannabinoid receptor-interacting protein 1
UniProt Protein Name
CB1 cannabinoid receptor-interacting protein 1
UniProt Gene Name
CNRIP1
UniProt Synonym Gene Names
C2orf32; CRIP-1

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The CNRIP1 cnrip1 (Catalog #AAA116485) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-164, Full length protein. The amino acid sequence is listed below: MGDLPGLVRL SIALRIQPND GPVFYKVDGQ RFGQNRTIKL LTGSSYKVEV KIKPSTLQVE NISIGGVLVP LELKSKEPDG DRVVYTGTYD TEGVTPTKSG ERQPIQITMP FTDIGTFETV WQVKFYNYHK RDHCQWGSPF SVIEYECKPN ETRSLMWVNK ESFL. It is sometimes possible for the material contained within the vial of "CB1 cannabinoid receptor-interacting protein 1 (CNRIP1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.