Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA113527_SDS_PAGE15.jpg SDS-PAGE

Contactin-associated protein 1 Recombinant Protein | CNTNAP1 recombinant protein

Recombinant Human Contactin-associated protein 1

Average rating 0.0
No ratings yet
Gene Names
CNTNAP1; P190; CASPR; NRXN4; CNTNAP
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Contactin-associated protein 1; N/A; Recombinant Human Contactin-associated protein 1; Neurexin IVNeurexin-4p190; CNTNAP1 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
26-356aa; Partial
Sequence
DEELVGPLYARSLGASSYYSLLTAPRFARLHGISGWSPRIGDPNPWLQIDLMKKHRIRAVATQGSFNSWDWVTRYMLLYGDRVDSWTPFYQRGHNSTFFGNVNESAVVRHDLHFHFTARYIRIVPLAWNPRGKIGLRLGLYGCPYKADILYFDGDDAISYRFPRGVSRSLWDVFAFSFKTEEKDGLLLHAEGAQGDYVTLELEGAHLLLHMSLGSSPIQPRPGHTTVSAGGVLNDQHWHYVRVDRFGRDVNFTLDGYVQRFILNGDFERLNLDTEMFIGGLVGAARKNLAYRHNFRGCIENVIFNRVNIADLAVRRHSRITFEGKVAFRCL
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

product-image-AAA113527_SDS_PAGE15.jpg SDS-PAGE
Related Product Information for CNTNAP1 recombinant protein
Ses to play a role in the formation of functional distinct domains critical for saltatory conduction of nerve impulses in myelinated nerve fibers. Ses to darcate the paranodal region of the axo-glial junction. In association with contactin may have a role in the signaling between axons and myelinating glial cells.
Product Categories/Family for CNTNAP1 recombinant protein
References
Identification of a novel contactin-associated transmembrane receptor with multiple domains implicated in protein-protein interactions.Peles E., Nativ M., Lustig M., Grumet M., Schilling J., Martinez R., Plowman G.D., Schlessinger J.EMBO J. 16:978-988(1997)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
53.8 kDa
NCBI Official Full Name
contactin-associated protein 1
NCBI Official Synonym Full Names
contactin associated protein 1
NCBI Official Symbol
CNTNAP1
NCBI Official Synonym Symbols
P190; CASPR; NRXN4; CNTNAP
NCBI Protein Information
contactin-associated protein 1
UniProt Protein Name
Contactin-associated protein 1
UniProt Gene Name
CNTNAP1
UniProt Synonym Gene Names
CASPR; NRXN4; Caspr; Caspr1
UniProt Entry Name
CNTP1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The CNTNAP1 cntnap1 (Catalog #AAA113527) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 26-356aa; Partial. The amino acid sequence is listed below: DEELVGPLYA RSLGASSYYS LLTAPRFARL HGISGWSPRI GDPNPWLQID LMKKHRIRAV ATQGSFNSWD WVTRYMLLYG DRVDSWTPFY QRGHNSTFFG NVNESAVVRH DLHFHFTARY IRIVPLAWNP RGKIGLRLGL YGCPYKADIL YFDGDDAISY RFPRGVSRSL WDVFAFSFKT EEKDGLLLHA EGAQGDYVTL ELEGAHLLLH MSLGSSPIQP RPGHTTVSAG GVLNDQHWHY VRVDRFGRDV NFTLDGYVQR FILNGDFERL NLDTEMFIGG LVGAARKNLA YRHNFRGCIE NVIFNRVNIA DLAVRRHSRI TFEGKVAFRC L. It is sometimes possible for the material contained within the vial of "Contactin-associated protein 1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.