Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA199561_WB11.jpg WB (Western Blot) (WB Suggested Anti-CNTNAP1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Lung)

Rabbit CNTNAP1 Polyclonal Antibody | anti-CNTNAP1 antibody

CNTNAP1 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
CNTNAP1; CHN3; P190; CASPR; NRXN4; CNTNAP
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CNTNAP1, Antibody; CNTNAP1 antibody - N-terminal region; anti-CNTNAP1 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LQIDLMKKHRIRAVATQGSFNSWDWVTRYMLLYGDRVDSWTPFYQRGHNS
Sequence Length
1384
Applicable Applications for anti-CNTNAP1 antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human CNTNAP1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-CNTNAP1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Lung)

product-image-AAA199561_WB11.jpg WB (Western Blot) (WB Suggested Anti-CNTNAP1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Lung)

WB (Western Blot)

(Host: RabbitTarget Name: CNTNAP1Sample Type: Fetal LungLane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 1ug/mlPeptide Concentration: 5ug/mlLysate Quantity: 25ug/lane/LaneGel Concentration: 0.12)

product-image-AAA199561_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: CNTNAP1Sample Type: Fetal LungLane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 1ug/mlPeptide Concentration: 5ug/mlLysate Quantity: 25ug/lane/LaneGel Concentration: 0.12)

WB (Western Blot)

(Host: RabbitTarget Name: CNTNAP1Sample Tissue: Human PANC1 Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA199561_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: CNTNAP1Sample Tissue: Human PANC1 Whole CellAntibody Dilution: 1ug/ml)
Related Product Information for anti-CNTNAP1 antibody
This is a rabbit polyclonal antibody against CNTNAP1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: CNTNAP1 was initially identified as a 190-kD protein associated with the contactin-PTPRZ1 complex. The 1,384-amino acid protein, also designated p190 or CASPR for 'contactin-associated protein,' includes an extracellular domain with several putative protein-protein interaction domains, a putative transmembrane domain, and a 74-amino acid cytoplasmic domain. The architecture of its extracellular domain is similar to that of neurexins, and this protein may be the signaling subunit of contactin, enabling recruitment and activation of intracellular signaling pathways in neurons.The gene product was initially identified as a 190-kD protein associated with the contactin-PTPRZ1 complex. The 1,381-amino acid protein, also designated p190 or CASPR for 'contactin-associated protein,' includes an extracellular domain with several putative protein-protein interaction domains, a putative transmembrane domain, and a 74-amino acid cytoplasmic domain. Northern blot analysis showed that the gene is transcribed predominantly in brain as a transcript of 6.2 kb, with weak expression in several other tissues tested. The architecture of its extracellular domain is similar to that of neurexins, and this protein may be the signaling subunit of contactin, enabling recruitment and activation of intracellular signaling pathways in neurons.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
156kDa
NCBI Official Full Name
contactin-associated protein 1
NCBI Official Synonym Full Names
contactin associated protein 1
NCBI Official Symbol
CNTNAP1
NCBI Official Synonym Symbols
CHN3; P190; CASPR; NRXN4; CNTNAP
NCBI Protein Information
contactin-associated protein 1
UniProt Protein Name
Contactin-associated protein 1
UniProt Gene Name
CNTNAP1
UniProt Synonym Gene Names
CASPR; NRXN4; Caspr; Caspr1
UniProt Entry Name
CNTP1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The CNTNAP1 cntnap1 (Catalog #AAA199561) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CNTNAP1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CNTNAP1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the CNTNAP1 cntnap1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LQIDLMKKHR IRAVATQGSF NSWDWVTRYM LLYGDRVDSW TPFYQRGHNS. It is sometimes possible for the material contained within the vial of "CNTNAP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.