Collagen alpha-3(IV) chain Recombinant Protein | COL4A3 recombinant protein
Recombinant Human Collagen alpha-3(IV) chain
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Collagen alpha-3(IV) chain; N/A; Recombinant Human Collagen alpha-3(IV) chain; Good pasture antigen; COL4A3 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1427-1668aa; Partial
Sequence
GLKGKRGDSGSPATWTTRGFVFTRHSQTTAIPSCPEGTVPLYSGFSFLFVQGNQRAHGQDLGTLGSCLQRFTTMPFLFCNVNDVCNFASRNDYSYWLSTPALMPMNMAPITGRALEPYISRCTVCEGPAIAIAVHSQTTDIPPCPHGWISLWKGFSFIMFTSAGSEGTGQALASPGSCLEEFRASPFLECHGRGTCNYYSNSYSFWLASLNPERMFRKPIPSTVKAGELEKIISRCQVCMKK
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Related Product Information for COL4A3 recombinant protein
Type IV collagen is the major structural component of glomerular basent membranes (GBM), forming a 'chicken-wire' meshwork together with laminins, proteoglycans and entactin/nidogen. Tumstatin, a cleavage fragment corresponding to the collagen alpha 3(IV) NC1 domain, possesses both anti-angiogenic and anti-tumor cell activity; these two anti-tumor properties may be regulated via RGD-independent ITGB3-mediated mechanisms.
Product Categories/Family for COL4A3 recombinant protein
References
Complete primary structure of the human alpha 3(IV) collagen chain. Coexpression of the alpha 3(IV) and alpha 4(IV) collagen chains in human tissues.Mariyama M., Leinonen A., Mochizuki T., Tryggvason K., Reeders S.T.J. Biol. Chem. 269:23013-23017(1994) Leinonen A.Structure of the human type IV collagen gene COL4A3 and mutations in autosomal Alport syndrome.Heidet L., Arrondel C., Forestier L., Cohen-Solal L., Mollet G., Gutierrez B., Stavrou C., Gubler M.-C., Antignac C.J. Am. Soc. Nephrol. 12:97-106(2001) Generation and annotation of the DNA sequences of human chromosomes 2 and 4.Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H., Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.Nature 434:724-731(2005) Two genes, COL4A3 and COL4A4 coding for the human alpha3(IV) and alpha4(IV) collagen chains are arranged head-to-head on chromosome 2q36.Momota R., Sugimoto M., Oohashi T., Kigasawa K., Yoshioka H., Ninomiya Y.FEBS Lett. 424:11-16(1998) Molecular cloning of the human Goodpasture antigen demonstrates it to be the alpha 3 chain of type IV collagen.Turner N., Mason P.J., Brown R., Fox M., Povey S., Rees A., Pusey C.D.J. Clin. Invest. 89:592-601(1992) Exon/intron structure of the human alpha 3(IV) gene encompassing the Goodpasture antigen (alpha 3(IV) NC1) . Identification of a potentially antigenic region at the triple helix/NC1 domain junction.Quinones S., Bernal D., Garcia-Sogo M., Elena S.F., Saus J.J. Biol. Chem. 267:19780-19784(1992) ErratumQuinones S., Bernal D., Garcia-Sogo M., Elena S.F., Saus J.J. Biol. Chem. 269:17358-17358(1994) Characterization and expression of multiple alternatively spliced transcripts of the Goodpasture antigen gene region. Goodpasture antibodies recognize recombinant proteins representing the autoantigen and one of its alternative forms.Penades J.R., Bernal D., Revert F., Johansson C., Fresquet V.J., Cervera J., Wieslander J., Quinones S., Saus J.Eur. J. Biochem. 229:754-760(1995) Distinct antitumor properties of a type IV collagen domain derived from basement membrane.Maeshima Y., Colorado P.C., Torre A., Holthaus K.A., Grunkemeyer J.A., Ericksen M.B., Hopfer H., Xiao Y., Stillman I.E., Kalluri R.J. Biol. Chem. 275:21340-21348(2000) Alternative splicing of the NC1 domain of the human alpha 3(IV) collagen gene. Differential expression of mRNA transcripts that predict three protein variants with distinct carboxyl regions.Feng L., Xia Y., Wilson C.B.J. Biol. Chem. 269:2342-2348(1994) Sequence and localization of a partial cDNA encoding the human alpha 3 chain of type IV collagen.Morrison K.E., Mariyama M., Yang-Feng T.L., Reeders S.T.Am. J. Hum. Genet. 49:545-554(1991) Ding J. The human mRNA encoding the Goodpasture antigen is alternatively spliced.Bernal D., Quinones S., Saus J.J. Biol. Chem. 268:12090-12094(1993) Complete primary structure of the human type IV collagen alpha 4(IV) chain. Comparison with structure and expression of the other alpha (IV) chains.Leinonen A., Mariyama M., Mochizuki T., Tryggvason K., Reeders S.T.J. Biol. Chem. 269:26172-26177(1994) Characterization of a novel type of serine/threonine kinase that specifically phosphorylates the human goodpasture antigen.Raya A., Revert F., Navarro S., Saus J.J. Biol. Chem. 274:12642-12649(1999) Two RGD-independent alpha vbeta 3 integrin binding sites on tumstatin regulate distinct anti-tumor properties.Maeshima Y., Colorado P.C., Kalluri R.J. Biol. Chem. 275:23745-23750(2000) Autosomal dominant Alport syndrome caused by a COL4A3 splice site mutation.van der Loop F.T.L., Heidet L., Timmer E.D.J., van den Bosch B.J.C., Leinonen A., Antignac C., Jefferson J.A., Maxwell A.P., Monnens L.A.H., Schroder C.H., Smeets H.J.M.Kidney Int. 58:1870-1875(2000) Quaternary organization of the goodpasture autoantigen, the alpha 3(IV) collagen chain. Sequestration of two cryptic autoepitopes by intrapromoter interactions with the alpha4 and alpha5 NC1 domains.Borza D.B., Bondar O., Todd P., Sundaramoorthy M., Sado Y., Ninomiya Y., Hudson B.G.J. Biol. Chem. 277:40075-40083(2002) Human tumstatin and human endostatin exhibit distinct antiangiogenic activities mediated by alpha v beta 3 and alpha 5 beta 1 integrins.Sudhakar A., Sugimoto H., Yang C., Lively J., Zeisberg M., Kalluri R.Proc. Natl. Acad. Sci. U.S.A. 100:4766-4771(2003) Implication of tumstatin in tumor progression of human bronchopulmonary carcinomas.Caudroy S., Cucherousset J., Lorenzato M., Zahm J.-M., Martinella-Catusse C., Polette M., Birembaut P.Hum. Pathol. 35:1218-1222(2004) Tryptic digestion of ubiquitin standards reveals an improved strategy for identifying ubiquitinated proteins by mass spectrometry.Denis N.J., Vasilescu J., Lambert J.-P., Smith J.C., Figeys D.Proteomics 7:868-874(2007) Mutations in the type IV collagen alpha 3 (COL4A3) gene in autosomal recessive Alport syndrome.Lemmink H.H., Mochizuki T., van den Heuvel L.P.W.J., Schroeder C.H., Barrientos A., Monnens L.A.H., van Oost B.A., Brunner H.G., Reeders S.T., Smeets H.J.M.Hum. Mol. Genet. 3:1269-1273(1994) Mutations in the COL4A4 and COL4A3 genes cause familial benign hematuria.Badenas C., Praga M., Tazon B., Heidet L., Arrondel C., Armengol A., Andres A., Morales E., Camacho J.A., Lens X., Davila S., Mila M., Antignac C., Darnell A., Torra R.J. Am. Soc. Nephrol. 13:1248-1254(2002) Novel COL4A5, COL4A4, and COL4A3 mutations in Alport syndrome.Nagel M., Nagorka S., Gross O.Hum. Mutat. 26:60-60(2005)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
30.6 kDa
NCBI Official Full Name
collagen alpha-3(IV) chain
NCBI Official Synonym Full Names
collagen type IV alpha 3
NCBI Official Symbol
COL4A3
NCBI Protein Information
collagen alpha-3(IV) chain
UniProt Protein Name
Collagen alpha-3(IV) chain
UniProt Gene Name
COL4A3
UniProt Entry Name
CO4A3_HUMAN
Similar Products
Product Notes
The COL4A3 col4a3 (Catalog #AAA116196) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1427-1668aa; Partial. The amino acid sequence is listed below: GLKGKRGDSG SPATWTTRGF VFTRHSQTTA IPSCPEGTVP LYSGFSFLFV QGNQRAHGQD LGTLGSCLQR FTTMPFLFCN VNDVCNFASR NDYSYWLSTP ALMPMNMAPI TGRALEPYIS RCTVCEGPAI AIAVHSQTTD IPPCPHGWIS LWKGFSFIMF TSAGSEGTGQ ALASPGSCLE EFRASPFLEC HGRGTCNYYS NSYSFWLASL NPERMFRKPI PSTVKAGELE KIISRCQVCM KK. It is sometimes possible for the material contained within the vial of "Collagen alpha-3(IV) chain, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
