Collagen alpha-3(IV) chain Recombinant Protein | COL4A3 recombinant protein

Recombinant Human Collagen alpha-3(IV) chain

Cat. Num. AAA116196

• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Collagen alpha-3(IV) chain; N/A; Recombinant Human Collagen alpha-3(IV) chain; Good pasture antigen; COL4A3 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1427-1668aa; Partial
• Sequence: GLKGKRGDSGSPATWTTRGFVFTRHSQTTAIPSCPEGTVPLYSGFSFLFVQGNQRAHGQDLGTLGSCLQRFTTMPFLFCNVNDVCNFASRNDYSYWLSTPALMPMNMAPITGRALEPYISRCTVCEGPAIAIAVHSQTTDIPPCPHGWISLWKGFSFIMFTSAGSEGTGQALASPGSCLEEFRASPFLECHGRGTCNYYSNSYSFWLASLNPERMFRKPIPSTVKAGELEKIISRCQVCMKK

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for COL4A3 recombinant protein

Type IV collagen is the major structural component of glomerular basent membranes (GBM), forming a 'chicken-wire' meshwork together with laminins, proteoglycans and entactin/nidogen. Tumstatin, a cleavage fragment corresponding to the collagen alpha 3(IV) NC1 domain, possesses both anti-angiogenic and anti-tumor cell activity; these two anti-tumor properties may be regulated via RGD-independent ITGB3-mediated mechanisms.

Product Categories/Family for COL4A3 recombinant protein

Cell adhesion

References

Complete primary structure of the human alpha 3(IV) collagen chain. Coexpression of the alpha 3(IV) and alpha 4(IV) collagen chains in human tissues.Mariyama M., Leinonen A., Mochizuki T., Tryggvason K., Reeders S.T.J. Biol. Chem. 269:23013-23017(1994) Leinonen A.Structure of the human type IV collagen gene COL4A3 and mutations in autosomal Alport syndrome.Heidet L., Arrondel C., Forestier L., Cohen-Solal L., Mollet G., Gutierrez B., Stavrou C., Gubler M.-C., Antignac C.J. Am. Soc. Nephrol. 12:97-106(2001) Generation and annotation of the DNA sequences of human chromosomes 2 and 4.Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H., Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.Nature 434:724-731(2005) Two genes, COL4A3 and COL4A4 coding for the human alpha3(IV) and alpha4(IV) collagen chains are arranged head-to-head on chromosome 2q36.Momota R., Sugimoto M., Oohashi T., Kigasawa K., Yoshioka H., Ninomiya Y.FEBS Lett. 424:11-16(1998) Molecular cloning of the human Goodpasture antigen demonstrates it to be the alpha 3 chain of type IV collagen.Turner N., Mason P.J., Brown R., Fox M., Povey S., Rees A., Pusey C.D.J. Clin. Invest. 89:592-601(1992) Exon/intron structure of the human alpha 3(IV) gene encompassing the Goodpasture antigen (alpha 3(IV) NC1) . Identification of a potentially antigenic region at the triple helix/NC1 domain junction.Quinones S., Bernal D., Garcia-Sogo M., Elena S.F., Saus J.J. Biol. Chem. 267:19780-19784(1992) ErratumQuinones S., Bernal D., Garcia-Sogo M., Elena S.F., Saus J.J. Biol. Chem. 269:17358-17358(1994) Characterization and expression of multiple alternatively spliced transcripts of the Goodpasture antigen gene region. Goodpasture antibodies recognize recombinant proteins representing the autoantigen and one of its alternative forms.Penades J.R., Bernal D., Revert F., Johansson C., Fresquet V.J., Cervera J., Wieslander J., Quinones S., Saus J.Eur. J. Biochem. 229:754-760(1995) Distinct antitumor properties of a type IV collagen domain derived from basement membrane.Maeshima Y., Colorado P.C., Torre A., Holthaus K.A., Grunkemeyer J.A., Ericksen M.B., Hopfer H., Xiao Y., Stillman I.E., Kalluri R.J. Biol. Chem. 275:21340-21348(2000) Alternative splicing of the NC1 domain of the human alpha 3(IV) collagen gene. Differential expression of mRNA transcripts that predict three protein variants with distinct carboxyl regions.Feng L., Xia Y., Wilson C.B.J. Biol. Chem. 269:2342-2348(1994) Sequence and localization of a partial cDNA encoding the human alpha 3 chain of type IV collagen.Morrison K.E., Mariyama M., Yang-Feng T.L., Reeders S.T.Am. J. Hum. Genet. 49:545-554(1991) Ding J. The human mRNA encoding the Goodpasture antigen is alternatively spliced.Bernal D., Quinones S., Saus J.J. Biol. Chem. 268:12090-12094(1993) Complete primary structure of the human type IV collagen alpha 4(IV) chain. Comparison with structure and expression of the other alpha (IV) chains.Leinonen A., Mariyama M., Mochizuki T., Tryggvason K., Reeders S.T.J. Biol. Chem. 269:26172-26177(1994) Characterization of a novel type of serine/threonine kinase that specifically phosphorylates the human goodpasture antigen.Raya A., Revert F., Navarro S., Saus J.J. Biol. Chem. 274:12642-12649(1999) Two RGD-independent alpha vbeta 3 integrin binding sites on tumstatin regulate distinct anti-tumor properties.Maeshima Y., Colorado P.C., Kalluri R.J. Biol. Chem. 275:23745-23750(2000) Autosomal dominant Alport syndrome caused by a COL4A3 splice site mutation.van der Loop F.T.L., Heidet L., Timmer E.D.J., van den Bosch B.J.C., Leinonen A., Antignac C., Jefferson J.A., Maxwell A.P., Monnens L.A.H., Schroder C.H., Smeets H.J.M.Kidney Int. 58:1870-1875(2000) Quaternary organization of the goodpasture autoantigen, the alpha 3(IV) collagen chain. Sequestration of two cryptic autoepitopes by intrapromoter interactions with the alpha4 and alpha5 NC1 domains.Borza D.B., Bondar O., Todd P., Sundaramoorthy M., Sado Y., Ninomiya Y., Hudson B.G.J. Biol. Chem. 277:40075-40083(2002) Human tumstatin and human endostatin exhibit distinct antiangiogenic activities mediated by alpha v beta 3 and alpha 5 beta 1 integrins.Sudhakar A., Sugimoto H., Yang C., Lively J., Zeisberg M., Kalluri R.Proc. Natl. Acad. Sci. U.S.A. 100:4766-4771(2003) Implication of tumstatin in tumor progression of human bronchopulmonary carcinomas.Caudroy S., Cucherousset J., Lorenzato M., Zahm J.-M., Martinella-Catusse C., Polette M., Birembaut P.Hum. Pathol. 35:1218-1222(2004) Tryptic digestion of ubiquitin standards reveals an improved strategy for identifying ubiquitinated proteins by mass spectrometry.Denis N.J., Vasilescu J., Lambert J.-P., Smith J.C., Figeys D.Proteomics 7:868-874(2007) Mutations in the type IV collagen alpha 3 (COL4A3) gene in autosomal recessive Alport syndrome.Lemmink H.H., Mochizuki T., van den Heuvel L.P.W.J., Schroeder C.H., Barrientos A., Monnens L.A.H., van Oost B.A., Brunner H.G., Reeders S.T., Smeets H.J.M.Hum. Mol. Genet. 3:1269-1273(1994) Mutations in the COL4A4 and COL4A3 genes cause familial benign hematuria.Badenas C., Praga M., Tazon B., Heidet L., Arrondel C., Armengol A., Andres A., Morales E., Camacho J.A., Lens X., Davila S., Mila M., Antignac C., Darnell A., Torra R.J. Am. Soc. Nephrol. 13:1248-1254(2002) Novel COL4A5, COL4A4, and COL4A3 mutations in Alport syndrome.Nagel M., Nagorka S., Gross O.Hum. Mutat. 26:60-60(2005)

NCBI and Uniprot Product Information

• NCBI GI #: 89142730
• NCBI GeneID: 1285
• NCBI Accession #: NP_000082.2
• NCBI GenBank Nucleotide #: NM_000091.4
• UniProt Accession #: Q01955; Q53QQ1; Q53R14; Q53RW8; Q9BQT2; Q9NYC4; Q9UDJ9; Q9UDK9; Q9UDL0; Q9UDL1
• Molecular Weight: 30.6 kDa
• NCBI Official Full Name: collagen alpha-3(IV) chain
• NCBI Official Synonym Full Names: collagen type IV alpha 3
• NCBI Official Symbol: COL4A3
• NCBI Protein Information: collagen alpha-3(IV) chain
• UniProt Protein Name: Collagen alpha-3(IV) chain
• UniProt Gene Name: COL4A3
• UniProt Entry Name: CO4A3_HUMAN