COVID 19 Nucleocapsid (NP) HKU1 Coronavirus Recombinant Protein | COVID-19 recombinant protein
Human Coronavirus (HKU1) Nucleocapsid Protein, His tag, E Coli
Reactivity
Human
Purity
> 95% as analyzed by SDS-PAGE. The concentration is 0.2 mg/ml.
Synonyms
COVID 19 Nucleocapsid (NP) HKU1 Coronavirus; N/A; Human Coronavirus (HKU1) Nucleocapsid Protein, His tag, E Coli; 2019 Novel Coronavirus; Coronavirus; CoV; COVID-19 virus; HCoV-2; Human Coronavirus 2019; SARS2; SARS-CoV-2; Severe acute respiratory syndrome coronavirus 2; Nucleocapsid; Nucleoprotein (NP); HKU1; COVID-19 recombinant protein
Host
E Coli
Reactivity
Human
Purity/Purification
> 95% as analyzed by SDS-PAGE. The concentration is 0.2 mg/ml.
Form/Format
Purified protein solution after extensive dialysis against PBS, pH 7.4.
Sequence
MSYTPGHYAGSRSSSGNRSGILKKTSWADQSERNYQTFNRGRKTQPKFTVSTQPQGNTIPHYSWFSGITQFQKGRDFKFSDGQGVPIAFGVPPSEAKGYWYRHSRRSFKTADGQQKQLLPRWYFYYLGTGPYANASYGESLEGVFWVANHQADTSTPSDVSSRDPTTQEAIPTRFPPGTILPQGYYVEGSGRSASNSRPGSRSQSRGPNNRSLSRSNSNFRHSDSIVKPDMADEIANLVLAKLGKDSKPQQVTKQNAKEIRHKILTKPRQKRTPNKHCNVQQCFGKRGPSQNFGNAEMLKLGTNDPQFPILAELAPTPGAFFFGSKLDLVKRDSEADSPVKDVFELHYSGSIRFDSTLPGFETIMKVLEENLNAYVNSNQNTDSDSLSSKPQRKRGVKQLPEQFDSLNLSAGTQHISNDFTPEDHSLLATLDDPYVEDSVA
Expression system
HKU1, produced in E.coli is a single non-glycosylated polypeptide chain containing 441 amino acids. A fully biologically active molecule has a molecular mass of 49.1 kDa. The apparent molecular mass of the protein is approximately 56 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques.
Source
E. coli
Endotoxin
Less than 0.2 EU/?g determined by LAL test.
Preparation and Storage
Samples are stable for up to twelve months from date of receipt at -20°C to -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Related Product Information for COVID-19 recombinant protein
Background: Coronavirus N protein is required for coronavirus RNA synthesis, and has RNA chaperone activity that may be involved in template switch. Nucleocapsid protein is a most abundant protein of coronavirus. N protein packages the positive strand viral genome RNA into a helical ribonucleocapsid (RNP) and plays a fundamental role during virion assembly through its interactions with the viral genome and membrane protein M.Plays an important role in enhancing the efficiency of subgenomic viral RNA transcription as well as viral replication. Because of the conservation of N protein sequence and its strong immunogenicity, the N protein of coronavirus is chosen as a test tool.
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The COVID-19 (Catalog #AAA268918) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The Human Coronavirus (HKU1) Nucleocapsid Protein, His tag, E Coli reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: MSYTPGHYAG SRSSSGNRSG ILKKTSWADQ SERNYQTFNR GRKTQPKFTV STQPQGNTIP HYSWFSGITQ FQKGRDFKFS DGQGVPIAFG VPPSEAKGYW YRHSRRSFKT ADGQQKQLLP RWYFYYLGTG PYANASYGES LEGVFWVANH QADTSTPSDV SSRDPTTQEA IPTRFPPGTI LPQGYYVEGS GRSASNSRPG SRSQSRGPNN RSLSRSNSNF RHSDSIVKPD MADEIANLVL AKLGKDSKPQ QVTKQNAKEI RHKILTKPRQ KRTPNKHCNV QQCFGKRGPS QNFGNAEMLK LGTNDPQFPI LAELAPTPGA FFFGSKLDLV KRDSEADSPV KDVFELHYSG SIRFDSTLPG FETIMKVLEE NLNAYVNSNQ NTDSDSLSSK PQRKRGVKQL PEQFDSLNLS AGTQHISNDF TPEDHSLLAT LDDPYVEDSV A. It is sometimes possible for the material contained within the vial of "COVID 19 Nucleocapsid (NP) HKU1 Coronavirus, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
