TRPM4 blocking peptide
TRPM4 Peptide - N-terminal region
Gene Names
TRPM4; LTrpC4; PFHB1B; TRPM4B; hTRPM4
Reactivity
Tested Species: Human, RatPredicted Species Reactivity||Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse
Synonyms
TRPM4; N/A; TRPM4 Peptide - N-terminal region; TRPM4 blocking peptide
Reactivity
Tested Species: Human, Rat
Predicted Species Reactivity||Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse
Predicted Species Reactivity||Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse
Form/Format
Lyophilized powder
Concentration
1mg/mL in PBS (after reconstitution) (varies by lot)
Sequence Length
1214
Immunogen
Synthetic peptide located within the following region: ELLTVYSSEDGSEEFETIVLKALVKACGSSEASAYLDELRLAVAWNRVDI
Protein Size (# AA)
1214 amino acids
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for TRPM4 blocking peptide
Description: This is a synthetic peptide designed for use in combination with anti-TRPM4 antibody (Catalog #: MBS3202508 ). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Target Description: TRPM4 is a calcium-activated non selective (CAN) cation channel that mediates membrane depolarization. While it is activated by increase in intracellular Ca2+, it is impermeable to it. TRPM4 mediates transport of monovalent cations (Na+ > K+ > Cs+ > Li+), leading to depolarize the membrane. It thereby plays a central role in cadiomyocytes, neurons from entorhinal cortex, dorsal root and vomeronasal neurons, endocrine pancreas cells, kidney epithelial cells, cochlea hair cells etc. Participates in T-cell activation by modulating Ca2+ oscillations after T lymphocyte activation, which is required for NFAT-dependent IL2 production. TRPM4 is involved in myogenic constriction of cerebral arteries. It controls insulin secretion in pancreatic beta-cells. TRPM4 may also be involved in pacemaking or could cause irregular electrical activity under conditions of Ca2+ overload.
Target Description: TRPM4 is a calcium-activated non selective (CAN) cation channel that mediates membrane depolarization. While it is activated by increase in intracellular Ca2+, it is impermeable to it. TRPM4 mediates transport of monovalent cations (Na+ > K+ > Cs+ > Li+), leading to depolarize the membrane. It thereby plays a central role in cadiomyocytes, neurons from entorhinal cortex, dorsal root and vomeronasal neurons, endocrine pancreas cells, kidney epithelial cells, cochlea hair cells etc. Participates in T-cell activation by modulating Ca2+ oscillations after T lymphocyte activation, which is required for NFAT-dependent IL2 production. TRPM4 is involved in myogenic constriction of cerebral arteries. It controls insulin secretion in pancreatic beta-cells. TRPM4 may also be involved in pacemaking or could cause irregular electrical activity under conditions of Ca2+ overload.
Product Categories/Family for TRPM4 blocking peptide
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
134kDa
NCBI Official Synonym Full Names
transient receptor potential cation channel subfamily M member 4
NCBI Official Symbol
TRPM4
NCBI Official Synonym Symbols
LTrpC4; PFHB1B; TRPM4B; hTRPM4
NCBI Protein Information
transient receptor potential cation channel subfamily M member 4
UniProt Protein Name
Transient receptor potential cation channel subfamily M member 4
UniProt Gene Name
TRPM4
UniProt Synonym Gene Names
LTRPC4; hTRPM4; LTrpC-4; LTrpC4
UniProt Entry Name
TRPM4_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The TRPM4 trpm4 (Catalog #AAA201816) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The TRPM4 Peptide - N-terminal region reacts with Tested Species: Human, Rat Predicted Species Reactivity||Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse and may cross-react with other species as described in the data sheet. It is sometimes possible for the material contained within the vial of "TRPM4, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.