Beta-crystallin B2 (CRYBB2) Recombinant Protein | CRYBB2 recombinant protein
Recombinant Rabbit Beta-crystallin B2 (CRYBB2)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Beta-crystallin B2 (CRYBB2); N/A; Recombinant Rabbit Beta-crystallin B2 (CRYBB2); CRYBB2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-205aa; Full Length of Mature Protein
Sequence
ASDHQTQAGKPQPLNPKIIIFEQENFQGHSHELNGPCPNLKETGVEKAGSVLVQAGPWVGYEQANCKGEQFVFEKGEYPRWDSWTSSRRTDSLSSLRPIKVDSQEHKIILYENPNFTGKKMEIIDDDVPSFHAHGYQEKVSSVRVQSGTWVGYQYPGYRGLQYLLEKGDYKDSSDFGAPHPQVQSVRRIRDMQWHQRGAFHPTN
Species
Rabbit
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for CRYBB2 recombinant protein
Crystallins are separated into two classes: taxon-specific, or enzyme, and ubiquitous. The latter class constitutes the major proteins of vertebrate eye lens and maintains the transparency and refractive index of the lens. Since lens central fiber cells lose their nuclei during development, these crystallins are made and then retained throughout life, making them extremely stable proteins. Mammalian lens crystallins are divided into alpha, beta, and gamma families; beta and gamma crystallins are also considered as a superfamily. Alpha and beta families are further divided into acidic and basic groups. Seven protein regions exist in crystallins: four homologous motifs, a connecting peptide, and N- and C-terminal extensions. Beta-crystallins, the most heterogeneous, differ by the presence of the C-terminal extension (present in the basic group, none in the acidic group). Beta-crystallins form aggregates of different sizes and are able to self-associate to form dimers or to form heterodimers with other beta-crystallins. This gene, a beta basic group member, is part of a gene cluster with beta-A4, beta-B1, and beta-B3. A chain-terminating mutation was found to cause type 2 cerulean cataracts.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23,404 Da
NCBI Official Full Name
beta-crystallin B2
NCBI Official Symbol
CRYBB2
NCBI Protein Information
beta-crystallin B2
UniProt Protein Name
Beta-crystallin B2
UniProt Gene Name
CRYBB2
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The CRYBB2 crybb2 (Catalog #AAA115081) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-205aa; Full Length of Mature Protein. The amino acid sequence is listed below: ASDHQTQAGK PQPLNPKIII FEQENFQGHS HELNGPCPNL KETGVEKAGS VLVQAGPWVG YEQANCKGEQ FVFEKGEYPR WDSWTSSRRT DSLSSLRPIK VDSQEHKIIL YENPNFTGKK MEIIDDDVPS FHAHGYQEKV SSVRVQSGTW VGYQYPGYRG LQYLLEKGDY KDSSDFGAPH PQVQSVRRIR DMQWHQRGAF HPTN. It is sometimes possible for the material contained within the vial of "Beta-crystallin B2 (CRYBB2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.