Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Have a question or looking for a specific datasheet Manual/COA/MSDS?
Submit a Question

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Cytotoxic T-lymphocyte protein 4 (Ctla4) Recombinant Protein | Ctla4 recombinant protein

Recombinant Mouse Cytotoxic T-lymphocyte protein 4 (Ctla4), partial

Gene Names
Ctla4; Cd152; Ly-56; Ctla-4
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Cytotoxic T-lymphocyte protein 4 (Ctla4); Recombinant Mouse Cytotoxic T-lymphocyte protein 4 (Ctla4); partial; Cytotoxic T-lymphocyte protein 4; Cytotoxic T-lymphocyte-associated antigen 4; CTLA-4; CD_antigen=; CD152; Ctla4 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
36-161aa; Extracellular Domain
Sequence
EAIQVTQPSVVLASSHGVASFPCEYSPSHNTDEVRVTVLRQTNDQMTEVCATTFTEKNTVGFLDYPFCSGTFNESRVNLTIQGLRAVDTGLYLCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSD
Sequence Length
161
Species
Mus musculus (Mouse)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-PAGE

SDS-PAGE
Related Product Information for Ctla4 recombinant protein
Inhibitory receptor acting as a major negative regulator of T-cell responses. The affinity of CTLA4 for its natural B7 family ligands, CD80 and CD86, is considerably stronger than the affinity of their cognate stimulatory coreceptor CD28
Product Categories/Family for Ctla4 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33.9 kDa
NCBI Official Full Name
cytotoxic T-lymphocyte protein 4 isoform 1
NCBI Official Synonym Full Names
cytotoxic T-lymphocyte-associated protein 4
NCBI Official Symbol
Ctla4
NCBI Official Synonym Symbols
Cd152; Ly-56; Ctla-4
NCBI Protein Information
cytotoxic T-lymphocyte protein 4; CD152 antigen; cytotoxic T-lymphocyte-associated antigen 4
UniProt Protein Name
Cytotoxic T-lymphocyte protein 4
UniProt Gene Name
Ctla4
UniProt Synonym Gene Names
Cd152; CTLA-4
UniProt Entry Name
CTLA4_MOUSE

Similar Products

Product Notes

The Ctla4 ctla4 (Catalog #AAA18459) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 36-161aa; Extracellular Domain. The amino acid sequence is listed below: EAIQVTQPSV VLASSHGVAS FPCEYSPSHN TDEVRVTVLR QTNDQMTEVC ATTFTEKNTV GFLDYPFCSG TFNESRVNLT IQGLRAVDTG LYLCKVELMY PPPYFVGMGN GTQIYVIDPE PCPDSD. It is sometimes possible for the material contained within the vial of "Cytotoxic T-lymphocyte protein 4 (Ctla4), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.