Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us

Cathepsin K Recombinant Protein | CATK recombinant protein

Recombinant mouse Cathepsin K

Gene Names
Ctsk; catK; Ms10q; MMS10-Q; AI323530
Reactivity
Mouse
Purity
Greater than 90% as determined by SDS-PAGE.
Synonyms
Cathepsin K; N/A; Recombinant mouse Cathepsin K; CATK recombinant protein
Ordering
Host
E Coli
Reactivity
Mouse
Purity/Purification
Greater than 90% as determined by SDS-PAGE.
Form/Format
20mM Tris-HCl based buffer, pH8.0
Sequence Positions
Full Length, 115-329aa
Sequence
PDSIDYRKKGYVTPVKNQGQCGSCWAFSSAGALEGQLKKKTGKLLALSPQNLVDCVTENYGCGGGYMTTAFQYVQQNGGIDSEDAYPYVGQDESCMYNATAKAAKCRGYREIPVGNEKALKRAVARVGPISVSIDASLASFQFYSRGVYYDENCDRDNVNHAVLVVGYGTQKGSKHWIIKNSWGESWGNKGYALLARNKNNACGITNMASFPKM
Tag Info
His-tag
Calculated MW
27.5 KD
Preparation and Storage
Store at -2°C, for extended storage, conserve at -20°C or -80°C. Repeated freezing and thawing is not recommended. Store working aliquots at 4° C for up to one week.
Related Product Information for CATK recombinant protein
Closely involved in osteoclastic bone resorption and may participate partially in the disorder of bone rodeling. Displays potent endoprotease activity against fibrinogen at acid pH. May play an important role in extracellular matrix degradation.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
cathepsin K preproprotein
NCBI Official Synonym Full Names
cathepsin K
NCBI Official Symbol
Ctsk
NCBI Official Synonym Symbols
catK; Ms10q; MMS10-Q; AI323530
NCBI Protein Information
cathepsin K
UniProt Protein Name
Cathepsin K
UniProt Gene Name
Ctsk

Similar Products

Product Notes

The CATK ctsk (Catalog #AAA309729) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is Full Length, 115-329aa. The Recombinant mouse Cathepsin K reacts with Mouse and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: PDSIDYRKKG YVTPVKNQGQ CGSCWAFSSA GALEGQLKKK TGKLLALSPQ NLVDCVTENY GCGGGYMTTA FQYVQQNGGI DSEDAYPYVG QDESCMYNAT AKAAKCRGYR EIPVGNEKAL KRAVARVGPI SVSIDASLAS FQFYSRGVYY DENCDRDNVN HAVLVVGYGT QKGSKHWIIK NSWGESWGNK GYALLARNKN NACGITNMAS FPKM. It is sometimes possible for the material contained within the vial of "Cathepsin K, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.