Cathepsin S Recombinant Protein | CATS recombinant protein
Recombinant mouse Cathepsin S
Gene Names
Ctss; Cats
Reactivity
Mouse
Purity
Greater than 90% as determined by SDS-PAGE.
Synonyms
Cathepsin S; N/A; Recombinant mouse Cathepsin S; CATS recombinant protein
Host
E Coli
Reactivity
Mouse
Purity/Purification
Greater than 90% as determined by SDS-PAGE.
Form/Format
20mM Tris-HCl based buffer, pH8.0
Sequence Positions
Full length, 123-340
Sequence
LPDTVDWREKGCVTEVKYQGSCGACWAFSAVGALEGQLKLKTGKLISLSAQNLVDCSNEEKYGNKGCGGGYMTEAFQYIIDNGGIEADASYPYKATDEKCHYNSKNRAATCSRYIQLPFGDEDALKEAVATKGPVSVGIDASHSSFFFYKSGVYDDPSCTGNVNHGVLVVGYGTLDGKDYWLVKNSWGLNFGDQGYIRMARNNKNHCGIASYCSYPEI
Sequence Length
340
Tag Info
His-tag
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for CATS recombinant protein
Thiol protease. Key protease responsible for the roval of the invariant chain from MHC class II molecules. The bond-specificity of this proteinase is in part similar to the specificities of cathepsin L and cathepsin N.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
27.8kD
NCBI Official Full Name
cathepsin S isoform 2 preproprotein
NCBI Official Synonym Full Names
cathepsin S
NCBI Official Symbol
Ctss
NCBI Official Synonym Symbols
Cats
NCBI Protein Information
cathepsin S
UniProt Protein Name
Cathepsin S
UniProt Gene Name
Ctss
UniProt Synonym Gene Names
Cats
Similar Products
Product Notes
The CATS ctss (Catalog #AAA309730) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is Full length, 123-340. The Recombinant mouse Cathepsin S reacts with Mouse and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: LPDTVDWREK GCVTEVKYQG SCGACWAFSA VGALEGQLKL KTGKLISLSA QNLVDCSNEE KYGNKGCGGG YMTEAFQYII DNGGIEADAS YPYKATDEKC HYNSKNRAAT CSRYIQLPFG DEDALKEAVA TKGPVSVGID ASHSSFFFYK SGVYDDPSCT GNVNHGVLVV GYGTLDGKDY WLVKNSWGLN FGDQGYIRMA RNNKNHCGIA SYCSYPEI. It is sometimes possible for the material contained within the vial of "Cathepsin S, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.