Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA283361_AD13.jpg Application Data (Recombinant Mouse CXCL12/SDF-1 chemoattract MOLT4 cells. The ED<sub>50</sub> for this effect is 8.49-33.94 ng/mL, corresponding to a specific activity of 2.95×10<sup>4 </sup>~1.18×10<sup>5</sup> units/mg.)

CXCL12/SDF-1 Recombinant Protein | Cxcl12 recombinant protein

Recombinant Mouse CXCL12/SDF-1 Protein

Average rating 0.0
No ratings yet
Synonyms
CXCL12/SDF-1; N/A; Recombinant Mouse CXCL12/SDF-1 Protein; Cxcl12;Stromal cell-derived factor 1;SDF-1;12-O-tetradecanoylphorbol 13-acetate repressedprotein 1;TPAR1;C-X-C motif chemokine 12;Pre-B cell growth-stimulating factor;PBSF;Thymiclymphoma cell-stimulating factor;TLSF;Sdf1; Cxcl12 recombinant protein
Ordering
Host
Pichia
Form/Format
Lyophilized from a 0.22 um filtered solution of PBS, pH7.4.
Sequence
KPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK
Species
Mouse
Endotoxin
<1EU/ug of the protein by LAL method.
Bio-Activity
Measured by its ability to chemoattract MOLT4 cells. The ED50 for this effect is 8.49-33.94ng/mL, corresponding to a specific activity of 2.95×104 ~1.18×105 units/mg.
Preparation and Storage
Store at -20 degree C. Store the lyophilized protein at -20 degree C to -80 degree C up to 1 year from the date of receipt.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

Application Data

(Recombinant Mouse CXCL12/SDF-1 chemoattract MOLT4 cells. The ED<sub>50</sub> for this effect is 8.49-33.94 ng/mL, corresponding to a specific activity of 2.95×10<sup>4 </sup>~1.18×10<sup>5</sup> units/mg.)

product-image-AAA283361_AD13.jpg Application Data (Recombinant Mouse CXCL12/SDF-1 chemoattract MOLT4 cells. The ED<sub>50</sub> for this effect is 8.49-33.94 ng/mL, corresponding to a specific activity of 2.95×10<sup>4 </sup>~1.18×10<sup>5</sup> units/mg.)

SDS-PAGE

(Recombinant Mouse CXCL12/SDF-1 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 10-15 kD.)

product-image-AAA283361_SDS_PAGE15.jpg SDS-PAGE (Recombinant Mouse CXCL12/SDF-1 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 10-15 kD.)
Related Product Information for Cxcl12 recombinant protein
Mouse Cxcl12 is a secreted and highly conserved protein which belongs to the intercrine alpha (chemokine CxC)family.CXCL12 is widely expressed in various organs including brain, kidney, skeletal muscle, heart, liver, and lymphoidorgans. Cxcl12 activates the C-X-C chemokine receptor CXCR4 to induce a rapid and transient rise in the level ofintracellular calcium ions and chemotaxis. It also binds to atypical chemokine receptor ACKR3 which activates the beta-arrestin pathway and acts as a scavenger receptor for SDF-1. Cxcl12 has several critical functions during embryonicdevelopment such as B-cell lymphopoiesis, myelopoiesis in bone marrow and heart ventricular septum formation. Cxcl12plays an important role in acting as a positive regulator of monocyte migration and a negative regulator of monocyteadhesion via the LYN kinase. It stimulates migration of monocytes and T-lymphocytes through its receptors, CXCR4 andACKR3, and decreases monocyte adherence to surfaces coated with ICAM-1, a ligand for beta-2 integrins. SDF1A/CXCR4signaling axis inhibits beta-2 integrin LFA-1 mediated adhesion of monocytes to ICAM-1 through LYN kinase. It also plays aprotective role after myocardial infarction, induces down-regulation and internalization of ACKR3 expressed in various cellsand stimulates the proliferation of bone marrow-derived b progenitor cells in the presence of IL-7 as well as growth of thestromal cell-dependent B-cell clone DW34 cells.
Product Categories/Family for Cxcl12 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
UniProt Protein Name
Stromal cell-derived factor 1
UniProt Gene Name
Cxcl12
UniProt Synonym Gene Names
Sdf1; SDF-1; TPAR1; PBSF; TLSF
UniProt Entry Name
SDF1_MOUSE

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The Cxcl12 cxcl12 (Catalog #AAA283361) is a Recombinant Protein produced from Pichia and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: KPVSLSYRCP CRFFESHIAR ANVKHLKILN TPNCALQIVA RLKNNNRQVC IDPKLKWIQE YLEKALNK. It is sometimes possible for the material contained within the vial of "CXCL12/SDF-1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.