Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us

Brain-Derived Neurotrophic Factor (BDNF) Active Protein | BDNF active protein

Recombinant Human Brain-Derived Neurotrophic Factor (BDNF) Active

Gene Names
BDNF; ANON2; BULN2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Brain-Derived Neurotrophic Factor (BDNF); N/A; Recombinant Human Brain-Derived Neurotrophic Factor (BDNF) Active; Brain-Derived Neurotrophic Factor; BDNF; Abrineurin; BDNF active protein
Ordering
Host
E Coli
Specificity
Brain. Highly expressed in hippocampus, amygdala, cerebral cortex and cerebellum. Also expressed in heart, lung, skeletal muscle, testis, prostate and placenta.
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized from a 0.2 mum Filtered 20 mM PB, 250 mM NaCl, pH 7.2
Sequence Positions
129-247aa; Full Length of Mature Protein
Sequence
HSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR
Sequence Length
247
Species
Human
Tag
Tag-Free
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The ED50 as determined by its ability to bind Human TrkB in functional ELISA is less than 5 ug/ml.
Subcellular Location
Secreted
Protein Families
NGF-beta Family
Classification
Cytokine
Subdivision
Growth Factor
Pathway
cAMP Signaling Pathway
Preparation and Storage
Store at -20 degree C. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for BDNF active protein
Relevance: Brain-Derived Neurotrophic Factor (BDNF) is a member of the neurotrophin family. Along with other structurally related neurotrophic factors NGF, NT-3 and NT-4, BDNF binds with high affinity to the TrkB kinase receptor. It also binds with the LNGFR (for low-affinity nerve growth factor receptor, also known as p75). BDNF promotes the survival, growth and differentiation of neurons. It serves as a major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS. BDNF expression is altered in neurodegenerative disorders such as Parkinson's and Alzheimer's disease.

Function: During development, promotes the survival and differentiation of selected neuronal populations of the peripheral and central nervous systems. Participates in axonal growth, pathfinding and in the modulation of dendritic growth and morphology. Major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS. The versatility of BDNF is emphasized by its contribution to a range of adaptive neuronal responses including long-term potentiation (LTP), long-term depression (LTD), certain forms of short-term synaptic plasticity, as well as homeostatic regulation of intrinsic neuronal excitability.
Product Categories/Family for BDNF active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
627
UniProt Accession #
Molecular Weight
13 kDa
NCBI Official Full Name
Brain-derived neurotrophic factor
NCBI Official Synonym Full Names
brain derived neurotrophic factor
NCBI Official Symbol
BDNF
NCBI Official Synonym Symbols
ANON2; BULN2
NCBI Protein Information
brain-derived neurotrophic factor
UniProt Protein Name
Brain-derived neurotrophic factor
UniProt Gene Name
BDNF
UniProt Synonym Gene Names
BDNF
UniProt Entry Name
BDNF_HUMAN

Similar Products

Product Notes

The BDNF bdnf (Catalog #AAA235614) is an Active Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 129-247aa; Full Length of Mature Protein. The amino acid sequence is listed below: HSDPARRGEL SVCDSISEWV TAADKKTAVD MSGGTVTVLE KVPVSKGQLK QYFYETKCNP MGYTKEGCRG IDKRHWNSQC RTTQSYVRAL TMDSKKRIGW RFIRIDTSCV CTLTIKRGR. It is sometimes possible for the material contained within the vial of "Brain-Derived Neurotrophic Factor (BDNF), Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.