Interleukin-36 alpha protein (Il36a) Active Protein | Il36a active protein
Recombinant Mouse Interleukin-36 alpha protein (Il36a) (Active)
Gene Names
Il1f6; Fil1; Il1f9; Il36a; IL-1H1; IL1RP2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Interleukin-36 alpha protein (Il36a); N/A; Recombinant Mouse Interleukin-36 alpha protein (Il36a) (Active); FIL1 epsilon; IL-1 epsilon; Interleukin-1 family member 6; IL-1F6; Interleukin-1 homolog 1; Il36a active protein
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized
Sequence Positions
1-160. Full Length
Sequence
MNKEKELRAASPSLRHVQDLSSRVWILQNNILTAVPRKEQTVPVTITLLPCQYLDTLETNRGDPTYMGVQRPMSCLFCTKDGEQPVLQLGEGNIMEMYNKKEPVKASLFYHKKSGTTSTFESAAFPGWFIAVCSKGSCPLILTQELGEIFITDFEMIVVH
Species
Mus musculus (Mouse)
Biological Activity
Fully biologically active when compared to standard. The specific activity determined by its ability in a functional ELISA. Immobilized rMuIL-36alpha at 1 ug/mL can bind recombinant murine IL-1 Rrp2 with a range of 0.15-5 ug/mL.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Protein Note
Protein will be provided with aseptic processing and endotoxin removal.
Preparation and Storage
Generally, the shelf life of liquid form is 6 months at -20/-80 degree C. The shelf life of lyophilized form is 12 months at -20/-80 degree C.
Related Product Information for Il36a active protein
Cytokine that binds to and signals through the IL1RL2/IL-36R receptor which in turn activates NF-kappa-B and MAPK signaling pathways in target cells linked to a pro-inflammatory response. Part of the IL-36 signaling system that is thought to be present in epithelial barriers and to take part in local inflammatory response; similar to the IL-1 system with which it shares the coreceptor IL1RAP. Seems to be involved in skin inflammatory response by acting on keratinocytes, dendritic cells and indirectly on T cells to drive tissue infiltration, cell maturation and cell proliferation. Induces the production of proinflammatory cytokines, including IL-12, Il-1 beta, IL-6, TNF-alpha and IL-23 in bone marrow-derived dendritic cells (BMDCs). Involved in dendritic cell maturation by stimulating the surface expression of CD80, CD86 and MHC class II. Induces the production of IFN-gamma, IL-4 and IL-17 by cultured CD4(+) T cells and splenocytes. May play a role in proinflammatory effects in the lung: induces the expression of CXCL1 and CXCL2 in the lung, and the expression of TNF-alpha, IL-36c, IL-1A, IL-1B, CXCL1 and CXCL2 in isolated splenic CD11c(+) alveolar macrophages. May be involved in T cell maturation by stimulating the surface expression of CD40 and modestly CD80 and CD86 in splenic CD11c(+) cells. May be involved in CD4(+) T cell proliferation. Induces NF-kappa B activation in macrophages. {ECO:0000269|PubMed:21860022, ECO:0000269|PubMed:21965679, ECO:0000269|PubMed:23029241, ECO:0000269|PubMed:24829417}.
Product Categories/Family for Il36a active protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
18.0 kDa
NCBI Official Full Name
interleukin-36 alpha
NCBI Official Synonym Full Names
interleukin 1 family, member 6
NCBI Official Symbol
Il1f6
NCBI Official Synonym Symbols
Fil1; Il1f9; Il36a; IL-1H1; IL1RP2
NCBI Protein Information
interleukin-36 alpha
UniProt Protein Name
Interleukin-36 alpha
UniProt Gene Name
Il36a
UniProt Synonym Gene Names
Fil1e; Il1e; Il1f6; Il1h1; IL-1 epsilon; IL-1F6; IL-1H1
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The Il36a il36a (Catalog #AAA114251) is an Active Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-160. Full Length. The amino acid sequence is listed below: MNKEKELRAA SPSLRHVQDL SSRVWILQNN ILTAVPRKEQ TVPVTITLLP CQYLDTLETN RGDPTYMGVQ RPMSCLFCTK DGEQPVLQLG EGNIMEMYNK KEPVKASLFY HKKSGTTSTF ESAAFPGWFI AVCSKGSCPL ILTQELGEIF ITDFEMIVVH. It is sometimes possible for the material contained within the vial of "Interleukin-36 alpha protein (Il36a), Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
