Kidney-associated antigen 1(KAAG1) Active Protein | KAAG1 active protein
Recombinant Human Kidney-associated antigen 1(KAAG1)(Active)
Gene Names
KAAG1; RU2AS
Purity
Greater than 90% as determined by SDS-PAGE.
Synonyms
Kidney-associated antigen 1(KAAG1); N/A; Recombinant Human Kidney-associated antigen 1(KAAG1)(Active); RU2AS; KAAG1 active protein
Host
E coli
Purity/Purification
Greater than 90% as determined by SDS-PAGE.
Form/Format
Lyophilized powder
Lyophilized from a 0.2 um sterile filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Lyophilized from a 0.2 um sterile filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Sequence Positions
1-84aa; Full Length
Sequence
MDDDAAPRVEGVPVAVHKHALHDGLRQVAGPGAAAAHLPRWPPPQLAASRREAPPLSQRPHRTQGAGSPPETNEKLTNPQVKEK$
Species
Homo sapiens (Human)
Tag
C-terminal 6xHis-tagged
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Research Area
Cancer
Biological Activity
Measured by its binding ability in a functional ELISA. Immobilized Human KAAG1 at 2 ug/mL can bind Anti-KAAG1 recombinant antibody. The EC50 is 2.040-2.284 ng/mL.
Preparation and Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C. The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Product Categories/Family for KAAG1 active protein
References
"A new antigen recognized by cytolytic T lymphocytes on a human kidney tumor results from reverse strand transcription."Van den Eynde B.J., Gaugler B., Probst-Kepper M., Michaux L., Devuyst O., Lorge F., Weynants P., Boon T.. Exp. Med. 190:1793-1800 (1999)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
8,969 Da
NCBI Official Full Name
kidney-associated antigen 1
NCBI Official Synonym Full Names
kidney associated antigen 1
NCBI Official Symbol
KAAG1
NCBI Official Synonym Symbols
RU2AS
NCBI Protein Information
kidney-associated antigen 1; RU2 antisense gene protein
UniProt Protein Name
Kidney-associated antigen 1
UniProt Gene Name
KAAG1
UniProt Synonym Gene Names
RU2AS
UniProt Entry Name
KAAG1_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The KAAG1 kaag1 (Catalog #AAA279253) is an Active Protein produced from E coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-84aa; Full Length. The amino acid sequence is listed below: MDDDAAPRVE GVPVAVHKHA LHDGLRQVAG PGAAAAHLPR WPPPQLAASR REAPPLSQRP HRTQGAGSPP ETNEKLTNPQ VKEK$. It is sometimes possible for the material contained within the vial of "Kidney-associated antigen 1(KAAG1), Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
