Kidney-associated antigen 1(KAAG1) Active Protein | KAAG1 active protein

Recombinant Human Kidney-associated antigen 1(KAAG1)(Active)

Cat. Num. AAA279253

• Gene Names: KAAG1; RU2AS
• Purity: Greater than 90% as determined by SDS-PAGE.
• Synonyms: Kidney-associated antigen 1(KAAG1); N/A; Recombinant Human Kidney-associated antigen 1(KAAG1)(Active); RU2AS; KAAG1 active protein

• Host: E coli
• Purity/Purification: Greater than 90% as determined by SDS-PAGE.
• Form/Format: Lyophilized powder; Lyophilized from a 0.2 um sterile filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
• Sequence Positions: 1-84aa; Full Length
• Sequence: MDDDAAPRVEGVPVAVHKHALHDGLRQVAGPGAAAAHLPRWPPPQLAASRREAPPLSQRPHRTQGAGSPPETNEKLTNPQVKEK$

• Species: Homo sapiens (Human)
• Tag: C-terminal 6xHis-tagged
• Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
• Research Area: Cancer
• Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Human KAAG1 at 2 ug/mL can bind Anti-KAAG1 recombinant antibody. The EC50 is 2.040-2.284 ng/mL.
• Preparation and Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C. The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.; Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.; We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Bioactivity

(Measured by its binding ability in a functional ELISA. Immobilized Human KAAG1 at 2?g/mL can bind Anti-KAAG1 recombinant antibody, the EC50 is 2.040-2.284 ng/mL.)

SDS-PAGE

((Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.)

Product Categories/Family for KAAG1 active protein

Active Protein & In Stock Protein

References

"A new antigen recognized by cytolytic T lymphocytes on a human kidney tumor results from reverse strand transcription."Van den Eynde B.J., Gaugler B., Probst-Kepper M., Michaux L., Devuyst O., Lorge F., Weynants P., Boon T.. Exp. Med. 190:1793-1800 (1999)

NCBI and Uniprot Product Information

• NCBI GI #: 31044434
• NCBI GeneID: 353219
• NCBI Accession #: NP_851854.1
• NCBI GenBank Nucleotide #: NM_181337.3
• UniProt Accession #: Q9UBP8
• Molecular Weight: 8,969 Da
• NCBI Official Full Name: kidney-associated antigen 1
• NCBI Official Synonym Full Names: kidney associated antigen 1
• NCBI Official Symbol: KAAG1
• NCBI Official Synonym Symbols: RU2AS
• NCBI Protein Information: kidney-associated antigen 1; RU2 antisense gene protein
• UniProt Protein Name: Kidney-associated antigen 1
• UniProt Gene Name: KAAG1
• UniProt Synonym Gene Names: RU2AS
• UniProt Entry Name: KAAG1_HUMAN