Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us

Placenta growth factor protein (PGF) Active Protein | PGF active protein

Recombinant Human Placenta growth factor protein (PGF) (Active)

Average rating 0.0
No ratings yet
Gene Names
PGF; PGFL; PIGF; PLGF; PlGF-2; D12S1900; SHGC-10760
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Placenta growth factor protein (PGF); N/A; Recombinant Human Placenta growth factor protein (PGF) (Active); PlGF; PGF active protein
Ordering
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized
Sequence Positions
19-170aa; Full Length of Mature Protein of Isoform 3
Sequence
LPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERRRPKGRGKRRREKQRPTDCHLCGDAVPRR
Species
Homo sapiens (Human)
Biological Activity
Fully biologically active when compared to standard. The biologically active as determined by its ability to chemoattract human monocytes using a concentration range of 5.0-50 ng/ml.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Protein Note
Protein will be provided with aseptic processing and endotoxin removal.
Preparation and Storage
Generally, the shelf life of liquid form is 6 months at -20/-80 degree C. The shelf life of lyophilized form is 12 months at -20/-80 degree C.
Related Product Information for PGF active protein
Growth factor active in angiogenesis and endothelial cell growth, stimulating their proliferation and migration. It binds to the receptor FLT1/VEGFR-1. Isoform PlGF-2 binds NRP1/neuropilin-1 and NRP2/neuropilin-2 in a heparin-dependent manner. Also promotes cell tumor growth. {ECO:0000269|PubMed:21215706}.
Product Categories/Family for PGF active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34.6 kDa
NCBI Official Full Name
placenta growth factor isoform 2
NCBI Official Synonym Full Names
placental growth factor
NCBI Official Symbol
PGF
NCBI Official Synonym Symbols
PGFL; PIGF; PLGF; PlGF-2; D12S1900; SHGC-10760
NCBI Protein Information
placenta growth factor
UniProt Protein Name
Placenta growth factor
UniProt Gene Name
PGF
UniProt Synonym Gene Names
PGFL; PLGF; PlGF

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The PGF pgf (Catalog #AAA114244) is an Active Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 19-170aa; Full Length of Mature Protein of Isoform 3. The amino acid sequence is listed below: LPAVPPQQWA LSAGNGSSEV EVVPFQEVWG RSYCRALERL VDVVSEYPSE VEHMFSPSCV SLLRCTGCCG DENLHCVPVE TANVTMQLLK IRSGDRPSYV ELTFSQHVRC ECRPLREKMK PERRRPKGRG KRRREKQRPT DCHLCGDAVP RR. It is sometimes possible for the material contained within the vial of "Placenta growth factor protein (PGF), Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.