Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online
product-image-AAA18755_SDS_PAGE.jpg SDS-PAGE

C-type lectin domain family 4 member C Active Protein | CLEC4C active protein

Recombinant Human C-type lectin domain family 4 member C

Gene Names
CLEC4C; DLEC; HECL; BDCA2; CD303; CLECSF7; CLECSF11; PRO34150
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
C-type lectin domain family 4 member C; N/A; Recombinant Human C-type lectin domain family 4 member C; Blood dendritic cell antigen 2; BDCA-2; C-type lectin superfamily member 7; Dendritic lectin; CD303; CLEC4C active protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
45-213aa; Extracellular Domain
Sequence
NFMYSKTVKRLSKLREYQQYHPSLTCVMEGKDIEDWSCCPTPWTSFQSSCYFISTGMQSWTKSQKNCSVMGADLVVINTREEQDFIIQNLKRNSSYFLGLSDPGGRRHWQWVDQTPYNENVTFWHSGEPNNLDERCAIINFRSSEEWGWNDIHCHVPQKSICKMKKIYI
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

product-image-AAA18755_SDS_PAGE.jpg SDS-PAGE
Related Product Information for CLEC4C active protein
Involved in antigen-capturing. Target ligand into antigen processing and peptide-loading compartments for presentation to T-cells. May mediate potent inhibition of induction of IFN-alpha/beta expression in plasmacytoid dendritic cells. May act as a signaling receptor that activates protein-tyrosine kinases and mobilizes intracellular calcium. Does not se to bind mannose.
Product Categories/Family for CLEC4C active protein
References
Molecular and genomic characterization of human DLEC, a novel member of the C-type lectin receptor gene family preferentially expressed on monocyte-derived dendritic cells.Arce I., Roda-Navarro P., Montoya M.C., Hernanz-Falcon P., Puig-Kroger A., Fernandez-Ruiz E.3.0.CO;2-X>Eur. J. Immunol. 31:2733-2740(2001) BDCA-2, a novel plasmacytoid dendritic cell-specific type II C-type lectin, mediates antigen capture and is a potent inhibitor of interferon alpha/beta induction.Dzionek A., Sohma Y., Nagafune J., Cella M., Colonna M., Facchetti F., Gunther G., Johnston I., Lanzavecchia A., Nagasaka T., Okada T., Vermi W., Winkels G., Yamamoto T., Zysk M., Yamaguchi Y., Schmitz J.J. Exp. Med. 194:1823-1834(2001) The secreted protein discovery initiative (SPDI) , a large-scale effort to identify novel human secreted and transmembrane proteins a bioinformatics assessment.Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P., Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E., Heldens S., Huang A., Kim H.S., Klimowski L., Jin Y., Johnson S., Lee J., Lewis L., Liao D., Mark M.R., Robbie E., Sanchez C., Schoenfeld J., Seshagiri S., Simmons L., Singh J., Smith V., Stinson J., Vagts A., Vandlen R.L., Watanabe C., Wieand D., Woods K., Xie M.-H., Yansura D.G., Yi S., Yu G., Yuan J., Zhang M., Zhang Z., Goddard A.D., Wood W.I., Godowski P.J., Gray A.M.Genome Res. 13:2265-2270(2003)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22 kDa
NCBI Official Full Name
C-type lectin domain family 4 member C isoform 1
NCBI Official Synonym Full Names
C-type lectin domain family 4 member C
NCBI Official Symbol
CLEC4C
NCBI Official Synonym Symbols
DLEC; HECL; BDCA2; CD303; CLECSF7; CLECSF11; PRO34150
NCBI Protein Information
C-type lectin domain family 4 member C
UniProt Protein Name
C-type lectin domain family 4 member C
UniProt Gene Name
CLEC4C
UniProt Synonym Gene Names
BDCA2; CLECSF11; CLECSF7; DLEC; HECL; BDCA-2
UniProt Entry Name
CLC4C_HUMAN

Similar Products

Product Notes

The CLEC4C clec4c (Catalog #AAA18755) is an Active Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 45-213aa; Extracellular Domain. The amino acid sequence is listed below: NFMYSKTVKR LSKLREYQQY HPSLTCVMEG KDIEDWSCCP TPWTSFQSSC YFISTGMQSW TKSQKNCSVM GADLVVINTR EEQDFIIQNL KRNSSYFLGL SDPGGRRHWQ WVDQTPYNEN VTFWHSGEPN NLDERCAIIN FRSSEEWGWN DIHCHVPQKS ICKMKKIYI . It is sometimes possible for the material contained within the vial of "C-type lectin domain family 4 member C, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.