C-type lectin domain family 4 member C Active Protein | CLEC4C active protein

Recombinant Human C-type lectin domain family 4 member C

Cat. Num. AAA18755

• Gene Names: CLEC4C; DLEC; HECL; BDCA2; CD303; CLECSF7; CLECSF11; PRO34150
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: C-type lectin domain family 4 member C; Recombinant Human C-type lectin domain family 4 member C; Blood dendritic cell antigen 2; BDCA-2; C-type lectin superfamily member 7; Dendritic lectin; CD303; CLEC4C active protein

• Host: E Coli
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 45-213aa; Extracellular Domain
• Sequence: NFMYSKTVKRLSKLREYQQYHPSLTCVMEGKDIEDWSCCPTPWTSFQSSCYFISTGMQSWTKSQKNCSVMGADLVVINTREEQDFIIQNLKRNSSYFLGLSDPGGRRHWQWVDQTPYNENVTFWHSGEPNNLDERCAIINFRSSEEWGWNDIHCHVPQKSICKMKKIYI

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for CLEC4C active protein

Involved in antigen-capturing. Target ligand into antigen processing and peptide-loading compartments for presentation to T-cells. May mediate potent inhibition of induction of IFN-alpha/beta expression in plasmacytoid dendritic cells. May act as a signaling receptor that activates protein-tyrosine kinases and mobilizes intracellular calcium. Does not se to bind mannose.

Product Categories/Family for CLEC4C active protein

Immunology

References

Molecular and genomic characterization of human DLEC, a novel member of the C-type lectin receptor gene family preferentially expressed on monocyte-derived dendritic cells.Arce I., Roda-Navarro P., Montoya M.C., Hernanz-Falcon P., Puig-Kroger A., Fernandez-Ruiz E.3.0.CO;2-X>Eur. J. Immunol. 31:2733-2740(2001) BDCA-2, a novel plasmacytoid dendritic cell-specific type II C-type lectin, mediates antigen capture and is a potent inhibitor of interferon alpha/beta induction.Dzionek A., Sohma Y., Nagafune J., Cella M., Colonna M., Facchetti F., Gunther G., Johnston I., Lanzavecchia A., Nagasaka T., Okada T., Vermi W., Winkels G., Yamamoto T., Zysk M., Yamaguchi Y., Schmitz J.J. Exp. Med. 194:1823-1834(2001) The secreted protein discovery initiative (SPDI) , a large-scale effort to identify novel human secreted and transmembrane proteins a bioinformatics assessment.Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P., Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E., Heldens S., Huang A., Kim H.S., Klimowski L., Jin Y., Johnson S., Lee J., Lewis L., Liao D., Mark M.R., Robbie E., Sanchez C., Schoenfeld J., Seshagiri S., Simmons L., Singh J., Smith V., Stinson J., Vagts A., Vandlen R.L., Watanabe C., Wieand D., Woods K., Xie M.-H., Yansura D.G., Yi S., Yu G., Yuan J., Zhang M., Zhang Z., Goddard A.D., Wood W.I., Godowski P.J., Gray A.M.Genome Res. 13:2265-2270(2003)

NCBI and Uniprot Product Information

• NCBI GI #: 18466806
• NCBI GeneID: 170482
• NCBI Accession #: NP_569708.1
• NCBI GenBank Nucleotide #: NM_130441.2
• UniProt Accession #: Q8WTT0; Q3T1C3; Q6UXS8; Q8WXX8; D3DUU3
• Molecular Weight: 22 kDa
• NCBI Official Full Name: C-type lectin domain family 4 member C isoform 1
• NCBI Official Synonym Full Names: C-type lectin domain family 4 member C
• NCBI Official Symbol: CLEC4C
• NCBI Official Synonym Symbols: DLEC; HECL; BDCA2; CD303; CLECSF7; CLECSF11; PRO34150
• NCBI Protein Information: C-type lectin domain family 4 member C
• UniProt Protein Name: C-type lectin domain family 4 member C
• UniProt Gene Name: CLEC4C
• UniProt Synonym Gene Names: BDCA2; CLECSF11; CLECSF7; DLEC; HECL; BDCA-2
• UniProt Entry Name: CLC4C_HUMAN