Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA79166_AD13.jpg Application Data

IL-6 active protein

Human IL-6

Average rating 0.0
No ratings yet
Gene Names
IL6; HGF; HSF; BSF2; IL-6; IFNB2
Reactivity
Human
Purity
> 98% by SDS-PAGE & silver stain
Synonyms
IL-6; N/A; Human IL-6; CTL differentiation factor, B-cell stimulatory factor 2, Hybridoma growth factor, Interferon beta-2; IL-6 active protein
Ordering
Host
E Coli
Reactivity
Human
Purity/Purification
> 98% by SDS-PAGE & silver stain
Form/Format
Lyophilized
Sequence
MAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Sequence Length
186
Endotoxin Level
< 0.1ng per ug of IL-6
Stabilizer
None
Buffer
PBS
Result by N-terminal sequencing
MAPVPPGE
Reconstitution
The lyophilized IL-6 should be reconstituted in water to a concentration not less than 100 ug/ml. This solution can be diluted into other buffered solutions or stored at -20°C for future use.
Biological Activity
The ED50 as determined by the dose-dependent stimulation of murine hybridoma B9 cells is in the range of 2-10 pg/ml.
Preparation and Storage
The lyophilized IL-6, though stable at room temperature, is best stored desiccated below 0 degree C. Reconstituted IL-6 should be stored in working aliquots at -20 degree C.

Application Data

product-image-AAA79166_AD13.jpg Application Data

Application Data

product-image-AAA79166_AD15.jpg Application Data
Related Product Information for IL-6 active protein
Interleukin 6 (IL-6) is a pleiotropic alpha-helical cytokine that plays important roles in acute phase reactions, inflammation, hematopoiesis, bone metabolism, and cancer progression. IL-6 activity is essential for the transition from acute inflammation to either acquired immunity or chronic inflammatory disease. It is secreted by multiple cell types as a 22 kDa-28 kDa phosphorylated and variably glycosylated molecule. Mature human IL6 is 183 amino acids (aa) in length and shares 41% aa sequence identity with mouse and rat IL-6. Alternate splicing generates several isoforms with internal deletions, some of which exhibit antagonistic properties. Human IL6 is equally active on mouse and rat cells. IL-6 induces signaling through a cell surface heterodimeric receptor complex composed of a ligand binding subunit (IL6 R) and a signal transducing subunit (gp130). IL-6 binds to IL-6 R, triggering IL-6 R association with gp130 and gp130 dimerization. Soluble forms of IL-6 R are generated by both alternate splicing and proteolytic cleavage. In a mechanism known as trans-signaling, complexes of soluble IL-6 and IL-6 R elicit responses from gp130expressing cells that lack cell surface IL-6 R. Trans-signaling enables a wider range of cell types to respond to IL-6, as the expression of gp130 is ubiquitous, while that of IL-6 R is predominantly restricted to hepatocytes, leukocytes, and lymphocytes. Soluble splice forms of gp130 block trans-signaling from IL-6/ IL-6 R but not from other cytokines that utilize gp130 as a co-receptor.
Product Categories/Family for IL-6 active protein
References
1. Van Snick, J. (1990) Annu. Rev. Immunol. 8:253. 2. Hodge, D.R. et al. (2005) Eur. J. Cancer 41:2502. 3. Jones, S.A. (2005) J. Immunol. 175:3468. 4. RoseJohn, S. et al. (2006) J. Leukoc. Biol. 80:227. 5. Hirano, T. et al. (1986) Nature 324:73. 6. Alberti, L. et al. (2005) Cancer Res. 65:2. 7. Kestler, D.P. et al. (1995) Blood 86:4559. 8. Kestler, D.P. et al. (1999) Am. J. Hematol. 61:169. 9. Bihl, M.P. et al. (2002) Am. J. Respir. Cell Mol. Biol. 27:48. 10. Chiu, C.P. et al. (1988) Proc. Natl. Acad. Sci. 85:7099. 11. Murakami, M. et al. (1993) Science 260:1808.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
21.1 kDa
NCBI Official Full Name
interleukin-6
NCBI Official Synonym Full Names
interleukin 6 (interferon, beta 2)
NCBI Official Symbol
IL6
NCBI Official Synonym Symbols
HGF; HSF; BSF2; IL-6; IFNB2
NCBI Protein Information
interleukin-6; CDF; BSF-2; IFN-beta-2; interferon beta-2; interleukin BSF-2; hybridoma growth factor; CTL differentiation factor; B-cell stimulatory factor 2; B-cell differentiation factor
UniProt Protein Name
Interleukin-6
UniProt Gene Name
IL6
UniProt Synonym Gene Names
IFNB2; IL-6; BSF-2; CDF; IFN-beta-2
UniProt Entry Name
IL6_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The IL-6 il6 (Catalog #AAA79166) is an Active Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The Human IL-6 reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: MAPVPPGEDS KDVAAPHRQP LTSSERIDKQ IRYILDGISA LRKETCNKSN MCESSKEALA ENNLNLPKMA EKDGCFQSGF NEETCLVKII TGLLEFEVYL EYLQNRFESS EEQARAVQMS TKVLIQFLQK AKNLDAITTP DPTTNASLLT KLQAQNQWLQ DMTTHLILRS FKEFLQSSLR ALRQM. It is sometimes possible for the material contained within the vial of "IL-6, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.